UniProt UniProt http://www.uniprot.org lima-1997-1 MAD analysis of FHIT, a putative human tumor suppressor from the HIT protein family. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lima C.D., D'Amico K.L., Naday I., Rosenbaum G., Westbrook E.M., Hendrickson W.A. hendw@convex.hhmi.columbia.edu Structure (0969-2126) 1997 Only protein-protein interactions imex curation fhit_human Bis(5'-adenosyl)-triphosphatase Diadenosine 5',5'''-P1,P3-triphosphate hydrolase Dinucleosidetriphosphatase AP3A hydrolase Fragile histidine triad protein FHIT Adenosine 5'-monophosphoramidase FHIT Adenylylsulfatase Adenylylsulfate-ammonia adenylyltransferase protein protein human Homo sapiens Human MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ fhit-1 1371711 n/a 1371712 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 1.85 A for 1FIT 1.90 A for 2FIT 2.40 A for 3FIT R-factor: 0.202 R-free: 0.225 for 1FIT; R-factor: 0.222 R-free: 0.249 for 2FIT; R-factor: 0.201 R-free: 0.249 for 3FIT Table 1