HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html satoh-1995-1 The N-terminal region of hepatitis C virus nonstructural protein 3 (NS3) is essential for stable complex formation with NS4A. chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Satoh S., Tanji Y., Hijikata M., Kimura K., Shimotohno K. kshimoto@gan.ncc.go.jp J. Virol. (0022-538X) 1995 imex curation Only protein-protein interactions imex curation satoh-1995-2 The N-terminal region of hepatitis C virus nonstructural protein 3 (NS3) is essential for stable complex formation with NS4A. chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Satoh S., Tanji Y., Hijikata M., Kimura K., Shimotohno K. kshimoto@gan.ncc.go.jp J. Virol. (0022-538X) 1995 imex curation Only protein-protein interactions imex curation p27958-pro_0000037573 Serine protease/helicase NS3 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQTYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAKGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADAGCSGGAYDIIICDECHSTDATSISGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLGFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMRKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVVT 1027 1657 p27958-pro_0000037574 Non-structural protein 4A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPDREVLYQEFDEMEEC 1658 1711 ns3-ns4a-14 1428635 n/a NS3 1428637 unspecified role unspecified role bait bait tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS4A 1428638 unspecified role unspecified role prey prey tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2A and 5 ns3-ns4a-15 1428635 n/a NS3 1428637 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false n/a NS4A 1428638 unspecified role unspecified role bait bait tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2A and 5 ns3-ns4a-16 1428635 n/a NS3 1428637 unspecified role unspecified role prey prey c-terminal dhfr tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS4A 1428638 unspecified role unspecified role bait bait tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2B and 3 ns3-ns4a-17 1428636 n/a NS3 1428637 unspecified role unspecified role bait bait tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal dhfr tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS4A 1428638 unspecified role unspecified role prey prey tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2A and 5