MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint jeong_woo-2013-1 Interleukin-32δ interacts with IL-32β and inhibits IL-32β-mediated IL-10 production human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jeong-Woo Kang1, Yun Sun Park1, Dong Hun Lee1, Man Sub Kim1, Yesol Bak1, Su Ho Park1, Sun Young Ham1, Young Yang3, Jin Tae Hong2, and Do-Young Yoon1 ydy4218@konkuk.ac.kr 2013 imex curation Kang J.W., Park Y.S., Lee D.H., Kim M.S., Bak Y., Park S.H., Ham S.Y., Yang Y., Hong J.T., Yoon D.Y. FEBS Lett. (0014-5793) Only protein-protein interactions jeong_woo-2013-2 Interleukin-32δ interacts with IL-32β and inhibits IL-32β-mediated IL-10 production human Homo sapiens Human fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Jeong-Woo Kang1, Yun Sun Park1, Dong Hun Lee1, Man Sub Kim1, Yesol Bak1, Su Ho Park1, Sun Young Ham1, Young Yang3, Jin Tae Hong2, and Do-Young Yoon1 ydy4218@konkuk.ac.kr 2013 imex curation Kang J.W., Park Y.S., Lee D.H., Kim M.S., Bak Y., Park S.H., Ham S.Y., Yang Y., Hong J.T., Yoon D.Y. FEBS Lett. (0014-5793) Only protein-protein interactions jeong_woo-2013-3 Interleukin-32δ interacts with IL-32β and inhibits IL-32β-mediated IL-10 production human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Jeong-Woo Kang1, Yun Sun Park1, Dong Hun Lee1, Man Sub Kim1, Yesol Bak1, Su Ho Park1, Sun Young Ham1, Young Yang3, Jin Tae Hong2, and Do-Young Yoon1 ydy4218@konkuk.ac.kr 2013 imex curation Kang J.W., Park Y.S., Lee D.H., Kim M.S., Bak Y., Park S.H., Ham S.Y., Yang Y., Hong J.T., Yoon D.Y. FEBS Lett. (0014-5793) Only protein-protein interactions p24001-2 Interleukin-32 Beta IL32 NK4 TAIF Natural killer cells protein 4 Tumor necrosis factor alpha-inducing factor protein protein human Homo sapiens Human MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK p24001-3 Interleukin-32 Delta IL32 NK4 TAIF Natural killer cells protein 4 Tumor necrosis factor alpha-inducing factor protein protein human Homo sapiens Human MKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK kpcd_human Protein kinase C delta type nPKC-delta PRKCD Tyrosine-protein kinase PRKCD PKCD protein protein human Homo sapiens Human MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED il32-il32-1 1448188 n/a IL-32 beta 1448191 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a IL-32 delta 1448192 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3 il32-il32-2 1448188 n/a IL-32 delta 1448192 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a IL-32 beta 1448191 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3 il32-prkcd-2 1448188 n/a PKC delta 1448193 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a IL-32 beta 1448191 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4a f4d il32-prkcd 1448189 n/a IL-32 beta 1448191 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a PKC delta 1448193 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5 We next verified the association profile of IL-32δ, IL-32β, and PKCδ by immunofluorescence staining in A549 cells. Both IL-32β and PKCδ were distributed in the cytosol in normal condition. However, they co-localized around the nucleus upon PMA treatment. Rottlerin disrupted their co-localization. As consistent with the immunoprecipitation data, IL-32δ induced the dissociation of IL-32β from PKCδ (Fig. 5). These data confirm the inhibitory effect of IL-32δ on IL-32β function. prkcd-il32 1448190 n/a PKC delta 1448193 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a IL-32 beta 1448191 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4b f4c