IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ catic-2013-6 Genome-wide Map of Nuclear Protein Degradation Shows NCoR1 Turnover as a Key to Mitochondrial Gene Regulation. mouse-3t3_l1 Mus musculus embryonic cells Fibroblast-like. Adipose like when confluent 3t3_l1 Mouse embryo cells Fibroblast-like. Adipose like when confluent ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Catic A., Suh C.Y., Hill C.T., Daheron L., Henkel T., Orford K.W., Dombkowski D.M., Liu T., Liu X.S., Scadden D.T. catic@post.harvard.edu, david_scadden@harvard.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation catic-2013-3 Genome-wide Map of Nuclear Protein Degradation Shows NCoR1 Turnover as a Key to Mitochondrial Gene Regulation. mouse-3t3_l1 Mus musculus embryonic cells Fibroblast-like. Adipose like when confluent 3t3_l1 Mouse embryo cells Fibroblast-like. Adipose like when confluent ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Catic A., Suh C.Y., Hill C.T., Daheron L., Henkel T., Orford K.W., Dombkowski D.M., Liu T., Liu X.S., Scadden D.T. catic@post.harvard.edu, david_scadden@harvard.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation catic-2013-5 Genome-wide Map of Nuclear Protein Degradation Shows NCoR1 Turnover as a Key to Mitochondrial Gene Regulation. mouse-3t3_l1 Mus musculus embryonic cells Fibroblast-like. Adipose like when confluent 3t3_l1 Mouse embryo cells Fibroblast-like. Adipose like when confluent ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Catic A., Suh C.Y., Hill C.T., Daheron L., Henkel T., Orford K.W., Dombkowski D.M., Liu T., Liu X.S., Scadden D.T. Two rounds of sequential Ch-IP were performed, order of coimmunoprecipitation not given. catic@post.harvard.edu, david_scadden@harvard.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation catic-2013-2 Genome-wide Map of Nuclear Protein Degradation Shows NCoR1 Turnover as a Key to Mitochondrial Gene Regulation. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Catic A., Suh C.Y., Hill C.T., Daheron L., Henkel T., Orford K.W., Dombkowski D.M., Liu T., Liu X.S., Scadden D.T. catic@post.harvard.edu, david_scadden@harvard.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation catic-2013-1 Genome-wide Map of Nuclear Protein Degradation Shows NCoR1 Turnover as a Key to Mitochondrial Gene Regulation. mouse-3t3_l1 Mus musculus embryonic cells Fibroblast-like. Adipose like when confluent 3t3_l1 Mouse embryo cells Fibroblast-like. Adipose like when confluent anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Catic A., Suh C.Y., Hill C.T., Daheron L., Henkel T., Orford K.W., Dombkowski D.M., Liu T., Liu X.S., Scadden D.T. catic@post.harvard.edu, david_scadden@harvard.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation catic-2013-4 Genome-wide Map of Nuclear Protein Degradation Shows NCoR1 Turnover as a Key to Mitochondrial Gene Regulation. mouse-3t3_l1 Mus musculus embryonic cells Fibroblast-like. Adipose like when confluent 3t3_l1 Mouse embryo cells Fibroblast-like. Adipose like when confluent anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Catic A., Suh C.Y., Hill C.T., Daheron L., Henkel T., Orford K.W., Dombkowski D.M., Liu T., Liu X.S., Scadden D.T. catic@post.harvard.edu, david_scadden@harvard.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation nduv1_mouse_gene NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial Ndufv1 Complex I-51kD NADH-ubiquinone oxidoreductase 51 kDa subunit gene gene mouse Mus musculus Mouse ncor1_mouse Nuclear receptor corepressor 1 Ncor1 Rxrip13 Retinoid X receptor-interacting protein 13 protein protein mouse Mus musculus Mouse MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD rt18b_mouse_gene 28S ribosomal protein S18b, mitochondrial Mrps18b 28S ribosomal protein S18-2, mitochondrial gene gene mouse Mus musculus Mouse akap1_mouse_gene Mouse A-kinase anchor protein 1, mitochondrial gene gene mouse Mus musculus Mouse cox8a_mouse_gene Cytochrome c oxidase subunit 8A, mitochondrial Cox8a Cox8 Cox8l Cytochrome c oxidase polypeptide VIII-liver Cytochrome c oxidase subunit 8-2 gene gene mouse Mus musculus Mouse creb1_mouse Cyclic AMP-responsive element-binding protein 1 Creb1 Creb-1 protein protein mouse Mus musculus Mouse MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD rm49_mouse_gene 39S ribosomal protein L49, mitochondrial Mrpl49 gene gene mouse Mus musculus Mouse oxnd1_mouse_gene Oxidoreductase NAD-binding domain-containing protein 1 Oxnad1 gene gene mouse Mus musculus Mouse qcr8_mouse_gene Cytochrome b-c1 complex subunit 8 Uqcrq Complex III subunit 8 Complex III subunit VIII Ubiquinol-cytochrome c reductase complex 9.5 kDa protein Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C gene gene mouse Mus musculus Mouse sywm_mouse_gene Tryptophan--tRNA ligase, mitochondrial Wars2 (Mt)TrpRS Tryptophanyl-tRNA synthetase gene gene mouse Mus musculus Mouse q01147-1 Cyclic AMP-responsive element-binding protein 1 Creb1 Creb-1 Alpha protein protein mouse Mus musculus Mouse MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD psb1_human Proteasome subunit beta type-1 PSMB1 PSC5 Proteasome component C5 Macropain subunit C5 Multicatalytic endopeptidase complex subunit C5 Proteasome gamma chain protein protein human Homo sapiens Human MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD psmd4_mouse 26S proteasome non-ATPase regulatory subunit 4 26S proteasome regulatory subunit S5A 26S proteasome regulatory subunit RPN10 Multiubiquitin chain-binding protein Psmd4 Mcb1 protein protein mouse Mus musculus Mouse MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATPGTEDSDDALLKMTINQQEFGRPGLPDLSSMTEEEQIAYAMQMSLQGTEFSQESADMDASSAMDTSDPVKEEDDYDVMQDPEFLQSVLENLPGVDPNNAAIRSVMGALASQATKDGKNDKKEEEKK ncor1-ndufv1-1 1469347 n/a 1469353 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469354 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig. 5G NCor1 promoter occupancy was significantly increased in Siah2-depleted cells. A second round of ChIP using anti-Ub Abs, showed a decrease in ubiquitinated NCoR1in the absence of Siah2. ncor1-mrps18b-1 1469347 n/a 1469354 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1469355 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5G, 5H NCor1 promoter occupancy was significantly increased in Siah2-depleted cells. A second round of ChIP using anti-Ub Abs, showed a decrease in ubiquitinated NCoR1in the absence of Siah2. ncor1-akap1-1 1469347 n/a 1469356 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469354 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig. 5G NCor1 promoter occupancy was significantly increased in Siah2-depleted cells. A second round of ChIP using anti-Ub Abs, showed a decrease in ubiquitinated NCoR1in the absence of Siah2. ncor1-cox8a 1469347 n/a 1469354 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1469357 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5A Treatment with CHEBI:52722 lactacystin increases occupancy levels of NCor1 but not CREB. creb1-cox8a 1469347 n/a 1469357 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469358 unspecified role unspecified role bait bait association association false false false Supp Fig. 5A Treatment with CHEBI:52722 lactacystin increases occupancy levels of NCor1 but not CREB. ncor1-mrpl49 1469347 n/a 1469359 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469354 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Supp. Fig. 5A Treatment with CHEBI:52722 lactacystin increases occupancy levels of NCor1 but not CREB. creb1-mrpl49 1469347 n/a 1469359 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469358 unspecified role unspecified role bait bait association association false false false Supp. Fig. 5A Treatment with CHEBI:52722 lactacystin increases occupancy levels of NCor1 but not CREB. ncor1-oxnad1 1469347 n/a 1469360 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469354 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Supp. Fig. 5A Treatment with CHEBI:52722 lactacystin increases occupancy levels of NCor1 but not CREB. creb1-oxnad1 1469347 n/a 1469360 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469358 unspecified role unspecified role bait bait association association false false false Supp. Fig. 5A Treatment with CHEBI:52722 lactacystin increases occupancy levels of NCor1 but not CREB. ncor1-uqcrq 1469347 n/a 1469354 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1469361 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5A Treatment with CHEBI:52722 lactacystin increases occupancy levels of NCor1 but not CREB. creb1-uqcrq 1469347 n/a 1469361 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469358 unspecified role unspecified role bait bait association association false false false Supp. Fig. 5A Treatment with CHEBI:52722 lactacystin increases occupancy levels of NCor1 but not CREB. ncor1-wars2 1469347 n/a 1469362 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469354 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Supp. Fig. 5A Treatment with CHEBI:52722 lactacystin increases occupancy levels of NCor1 but not CREB. creb1-wars2 1469347 n/a 1469358 unspecified role unspecified role bait bait n/a 1469362 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5A Treatment with CHEBI:52722 lactacystin increases occupancy levels of NCor1 but not CREB. ncor1-ndufv1-2 1469347 n/a 1469354 unspecified role unspecified role bait bait n/a 1469353 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7C, 5J Activation of genes following depolarization with the uncoupling ionophore FCCP was caused by Siah2-dependent removal of NCoR1 from target promoters ncor1-mrps18b-2 1469347 n/a 1469355 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469354 unspecified role unspecified role bait bait association association false false false Fig. 7C, 5J Activation of genes following depolarization with the uncoupling ionophore FCCP was caused by Siah2-dependent removal of NCoR1 from target promoters. ncor1-akap1-2 1469347 n/a 1469354 unspecified role unspecified role bait bait n/a 1469356 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7C, 5J Activation of genes following depolarization with the uncoupling ionophore FCCP was caused by Siah2-dependent removal of NCoR1 from target promoters ncor1-akap1 1469348 n/a 1469356 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469354 unspecified role unspecified role bait bait association association false false false Fig. 4F Co-occupancy of endogenous NCoR1 and CREB at these promoters was confirmed by sequential ChIP. Levels of NCoR1 showed depletion following CREB knockdown. ncor1-mrps18b 1469348 n/a 1469355 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469354 unspecified role unspecified role bait bait association association false false false Fig. 4F Co-occupancy of endogenous NCoR1 and CREB at these promoters was confirmed by sequential ChIP. Levels of NCoR1 showed depletion following CREB knockdown. ncor1-ndufv1 1469348 n/a 1469354 unspecified role unspecified role bait bait n/a 1469353 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4F Co-occupancy of endogenous NCoR1 and CREB at these promoters was confirmed by sequential ChIP. Levels of NCoR1 showed depletion following CREB knockdown. creb1-akap1 1469348 n/a 1469356 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469358 unspecified role unspecified role bait bait association association false false false Fig. 4F Co-occupancy of endogenous NCoR1 and CREB at these promoters was confirmed by sequential ChIP creb1-mrps18b 1469348 n/a 1469358 unspecified role unspecified role bait bait n/a 1469355 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4F Co-occupancy of endogenous NCoR1 and CREB at these promoters was confirmed by sequential ChIP creb1-ndufv1 1469348 n/a 1469358 unspecified role unspecified role bait bait n/a 1469353 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4F Co-occupancy of endogenous NCoR1 and CREB at these promoters was confirmed by sequential ChIP akap1-creb1 1469349 n/a 1469354 unspecified role unspecified role unspecified role unspecified role n/a 1469356 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469358 unspecified role unspecified role unspecified role unspecified role association association false false false Fig. 4G Co-occupancy of endogenous NCoR1 and CREB at these promoters was confirmed by sequential ChIP. Q01147 increases expression at RNA level of ENSMUSG00000018428 Q60974 decreases expression at RNA level of ENSMUSG00000018428 mrps18b-creb1 1469349 n/a 1469354 unspecified role unspecified role unspecified role unspecified role n/a 1469355 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469358 unspecified role unspecified role unspecified role unspecified role association association false false false Fig. 4G Co-occupancy of endogenous NCoR1 and CREB at these promoters was confirmed by sequential ChIP. Q01147 increases expression at RNA level of ENSMUSG00000024436 Q60974 decreases expression at RNA level of ENSMUSG00000024436 ndufv1-creb1 1469349 n/a 1469353 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469354 unspecified role unspecified role unspecified role unspecified role n/a 1469358 unspecified role unspecified role unspecified role unspecified role association association false false false Fig. 4G Co-occupancy of endogenous NCoR1 and CREB at these promoters was confirmed by sequential ChIP. Q60974 decreases expression at RNA level of ENSMUSG00000037916 Q01147 increases expression at RNA level of ENSMUSG00000037916 ncor1-creb1 1469350 n/a 1469358 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1469354 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 4H ncor1-creb1-1 1469350 n/a 1469354 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1469363 unspecified role unspecified role prey prey kid region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig 4H psmb1-psmd4 1469351 n/a 1469364 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1469365 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2E Expression of NCoR1 is controlled by a tetracycline repressor. ncor1-creb1-2 1469352 n/a 1469358 unspecified role unspecified role prey prey n/a 1469354 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 4E