MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint _-2013a-1 characterisation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1, Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1† f.sargent@dundee.ac.uk 2013 imex curation Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1,Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1†, Dow JM., Grahl S., Ward R., Evans R., Byron O., Norman DG., Palmer T., Sargent F. The FEBS journal Only protein-protein interactions _-2013a-2 characterisation in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1, Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1† f.sargent@dundee.ac.uk 2013 imex curation Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1,Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1†, Dow JM., Grahl S., Ward R., Evans R., Byron O., Norman DG., Palmer T., Sargent F. The FEBS journal Only protein-protein interactions _-2013a-3 characterisation in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1, Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1† f.sargent@dundee.ac.uk 2013 imex curation Jennifer M. Dow1*, Sabine Grahl1,4*, Richard Ward2, Rachael Evans1,Olwyn Byron3, David G. Norman2, Tracy Palmer1† and Frank Sargent1†, Dow JM., Grahl S., Ward R., Evans R., Byron O., Norman DG., Palmer T., Sargent F. The FEBS journal Only protein-protein interactions napd_ecoli Chaperone NapD yojF napD b2207 JW2195 NapA signal peptide-binding chaperone NapD protein protein ecoli Escherichia coli (strain K12) MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETP napa_ecoli Periplasmic nitrate reductase yojC yojD yojE napA b2206 JW2194 protein protein ecoli Escherichia coli (strain K12) MKLSRRSFMKANAVAAAAAAAGLSVPGVARAVVGQQEAIKWDKAPCRFCGTGCGVLVGTQQGRVVACQGDPDAPVNRGLNCIKGYFLPKIMYGKDRLTQPLLRMKNGKYDKEGEFTPITWDQAFDVMEEKFKTALKEKGPESIGMFGSGQWTIWEGYAASKLFKAGFRSNNIDPNARHCMASAVVGFMRTFGMDEPMGCYDDIEQADAFVLWGANMAEMHPILWSRITNRRLSNQNVTVAVLSTYQHRSFELADNGIIFTPQSDLVILNYIANYIIQNNAINQDFFSKHVNLRKGATDIGYGLRPTHPLEKAAKNPGSDASEPMSFEDYKAFVAEYTLEKTAEMTGVPKDQLEQLAQLYADPNKKVISYWTMGFNQHTRGVWANNLVYNLHLLTGKISQPGCGPFSLTGQPSACGTAREVGTFAHRLPADMVVTNEKHRDICEKKWNIPSGTIPAKIGLHAVAQDRALKDGKLNVYWTMCTNNMQAGPNINEERMPGWRDPRNFIIVSDPYPTVSALAADLILPTAMWVEKEGAYGNAERRTQFWRQQVQAPGEAKSDLWQLVQFSRRFKTEEVWPEDLLAKKPELRGKTLYEVLYATPEVSKFPVSELAEDQLNDESRELGFYLQKGLFEEYAWFGRGHGHDLAPFDDYHKARGLRWPVVNGKETQWRYSEGNDPYVKAGEGYKFYGKPDGKAVIFALPFEPAAEAPDEEYDLWLSTGRVLEHWHTGSMTRRVPELHRAFPEAVLFIHPLDAKARDLRRGDKVKVVSRRGEVISIVETRGRNRPPQGLVYMPFFDAAQLVNKLTLDATDPLSKETDFKKCAVKLEKV napa-napd-4 1454497 n/a NapD 1454500 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role unspecified role unspecified role partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a NapA 1454501 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role unspecified role unspecified role partially purified partially purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3 f5 napa-napd-5 1454498 n/a NapA 1454501 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified n/a NapD 1454500 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false f6 t1 napa-napd-6 1454499 n/a NapD 1454500 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a NapA 1454501 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f2 sf2 sf3 sf4