MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint avery-2013-1 Liver-type Fatty Acid Binding Protein Interacts with Hepatocyte Nuclear Factor in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Avery L. McIntosh1, Anca D. Petrescu1, Heather A. Hostetler3, Ann B. Kier2, and Friedhelm Schroeder1 fschroeder@cvm.tamu.edu 2013 Only protein-protein interactions imex curation Avery L. McIntosh1, Anca D. Petrescu1, Heather A. Hostetler3, Ann B. Kier2, and FriedhelmSchroeder1, McIntosh AL., Petrescu AD., Hostetler HA., Kier AB., Schroeder F., McIntosh AL., Petrescu AD., Hostetler HA., Kier AB., Schroeder F. FEBS letters avery-2013-2 Liver-type Fatty Acid Binding Protein Interacts with Hepatocyte Nuclear Factor in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Avery L. McIntosh1, Anca D. Petrescu1, Heather A. Hostetler3, Ann B. Kier2, and Friedhelm Schroeder1 fschroeder@cvm.tamu.edu 2013 Only protein-protein interactions imex curation Avery L. McIntosh1, Anca D. Petrescu1, Heather A. Hostetler3, Ann B. Kier2, and FriedhelmSchroeder1, McIntosh AL., Petrescu AD., Hostetler HA., Kier AB., Schroeder F., McIntosh AL., Petrescu AD., Hostetler HA., Kier AB., Schroeder F. FEBS letters avery-2013-3 Liver-type Fatty Acid Binding Protein Interacts with Hepatocyte Nuclear Factor rat-hepatocyte Rattus norvegicus hepatocytes hepatocyte Liver primary cell A hepatocyte is a cell of the main tissue of the liver. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Avery L. McIntosh1, Anca D. Petrescu1, Heather A. Hostetler3, Ann B. Kier2, and Friedhelm Schroeder1 fschroeder@cvm.tamu.edu 2013 Only protein-protein interactions imex curation Avery L. McIntosh1, Anca D. Petrescu1, Heather A. Hostetler3, Ann B. Kier2, and FriedhelmSchroeder1, McIntosh AL., Petrescu AD., Hostetler HA., Kier AB., Schroeder F., McIntosh AL., Petrescu AD., Hostetler HA., Kier AB., Schroeder F. FEBS letters fabpl_rat Fatty acid-binding protein, liver Fabp1 Liver-type fatty acid-binding protein Squalene- and sterol-carrier protein Z-protein p14 Fatty acid-binding protein 1 protein protein rat Rattus norvegicus (Rat) Rat MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIHNEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVYKRVSKRI hnf4a_rat Hepatocyte nuclear factor 4-alpha Hnf4a Hnf-4 Hnf4 Nr2a1 Tcf14 Nuclear receptor subfamily 2 group A member 1 Transcription factor 14 Transcription factor HNF-4 protein protein rat Rattus norvegicus (Rat) Rat MRLSKTLADMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNSSNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPISGINGDIRAKKIANITDVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSASDAPHAHHPLHPHLMQEHMGTNVIVANTMPSHLSNGQMCEWPRPRGQAATPETPQPSPPSGSGSESYKLLPGAITTIVKPPSAIPQPTITKQEAI fabp1-hnf4a 1436906 n/a L-FABP 1436909 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified tag cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a HNF4 alpha 1436910 unspecified role unspecified role fluorescence donor fluorescence donor purified purified tag cy3 label cy3 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false t1 f1 fabp1-hnf4a-1 1436907 n/a L-FABP 1436909 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified tag cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a HNF4 alpha 1436910 unspecified role unspecified role fluorescence donor fluorescence donor purified purified tag cy3 label cy3 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f2 fabp1-hnf4a-2 1436908 n/a L-FABP 1436909 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept fixed cell fixed cell tag cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a HNF4 alpha 1436910 unspecified role unspecified role fluorescence donor fluorescence donor fixed cell fixed cell tag cy3 label cy3 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false f3