MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2013g-2 Hepatitis B virus core protein interacts with CD59 to promote complement-mediated liver inflammation during chronic hepatitis B virus infection human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu D., Ni B., Wang L., Zhang M., Liu W., Wu Y. wei.liu.2005@gmail.com FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation anonymous-2013i-1 Hepatitis B virus core protein interacts with CD59 to promote complement-mediated liver inflammation during chronic hepatitis B virus infection human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). tap tandem affinity purification TAP TAP tap de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Liu D., Ni B., Wang L., Zhang M., Liu W., Wu Y. wei.liu.2005@gmail.com FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation anonymous-2013f-4 Hepatitis B virus core protein interacts with CD59 to promote complement-mediated liver inflammation during chronic hepatitis B virus infection human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy immunostaining immunostaining Liu D., Ni B., Wang L., Zhang M., Liu W., Wu Y. wei.liu.2005@gmail.com FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation q778i9_hbv Capsid protein Core antigen Core protein HBcAg p21.5 HBVgp4 C core protein protein hbv Hepatitis B virus (HBV) HBV MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC cd59_human CD59 glycoprotein CD59 Membrane attack complex inhibition factor MAC-inhibitory protein Protectin MEM43 antigen Membrane inhibitor of reactive lysis 20 kDa homologous restriction factor 1F5 antigen MIC11 MIN1 MIN2 MIN3 MSK21 protein protein human Homo sapiens Human MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP tpm1_human Tropomyosin alpha-1 chain TPM1 TMSA Tropomyosin-1 Alpha-tropomyosin C15orf13 protein protein human Homo sapiens Human MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI stn1_human CST complex subunit STN1 STN1 OBFC1 Oligonucleotide/oligosaccharide-binding fold-containing protein 1 Suppressor of cdc thirteen homolog protein protein human Homo sapiens Human MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF c-cd59-1 1435984 n/a HBc 1435987 unspecified role unspecified role bait bait living cell living cell n/a CD59 1435988 unspecified role unspecified role prey prey living cell living cell physical association physical association false false false f1c cd59-c 1435984 n/a CD59 1435988 unspecified role unspecified role bait bait living cell living cell n/a HBc 1435987 unspecified role unspecified role prey prey living cell living cell physical association physical association false false false f1c c-cd59 1435985 n/a CD59 1435988 unspecified role unspecified role prey prey living cell living cell n/a TPM1 1435989 unspecified role unspecified role prey prey living cell living cell n/a HBc 1435987 unspecified role unspecified role bait bait living cell living cell tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a OBFC1 1435990 unspecified role unspecified role prey prey living cell living cell association association false false false f1a f1b c-cd59-2 1435986 n/a HBc 1435987 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell n/a CD59 1435988 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell colocalization colocalization false false false f5