IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tam-2013-3 Protein Kinase C α Is a Central Signaling Node and Therapeutic Target for Breast Cancer Stem Cells. human-hmle Homo sapiens hmle Human immortalized mammary epithelial cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tam W.L., Lu H., Buikhuisen J., Soh B.S., Lim E., Reinhardt F., Wu Z.J., Krall J.A., Bierie B., Guo W., Chen X., Liu X.S., Brown M., Lim B., Weinberg R.A. Cancer - Interactions investigated in the context of cancer Figure 6: EMT was induced in HMLEs by ectopic expression of either the Twist or Snail transcription factors, (The authors have confirmed that the cells used in the assay were HMLE-Twist and HMLE-Snail cells.) weinberg@wi.mit.edu Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation tam-2013-1 Protein Kinase C α Is a Central Signaling Node and Therapeutic Target for Breast Cancer Stem Cells. human-hmle_namec Homo sapiens_Hmle_namec:Human mammary epithelial cell line (immortalized)- stable post EMT cells. hmle_namec Human mammary epithelial cell line (immortalized)- stable post EMT cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tam W.L., Lu H., Buikhuisen J., Soh B.S., Lim E., Reinhardt F., Wu Z.J., Krall J.A., Bierie B., Guo W., Chen X., Liu X.S., Brown M., Lim B., Weinberg R.A. Cancer - Interactions investigated in the context of cancer NAMECS:-Naturally Arising MEsenchymal Cells (NAMECs), isolated from bulk cultures of HMLE cells:these cells thave spontaneously undergone an EMT and are in a stable mesenchymal state. weinberg@wi.mit.edu Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation tam-2013-2 Protein Kinase C α Is a Central Signaling Node and Therapeutic Target for Breast Cancer Stem Cells. human-hmle Homo sapiens hmle Human immortalized mammary epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tam W.L., Lu H., Buikhuisen J., Soh B.S., Lim E., Reinhardt F., Wu Z.J., Krall J.A., Bierie B., Guo W., Chen X., Liu X.S., Brown M., Lim B., Weinberg R.A. Cancer - Interactions investigated in the context of cancer weinberg@wi.mit.edu Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation cadh1_human_gene Human CDH1gene:Epithelial cadherin gene gene human Homo sapiens Human fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL crum3_human_gene CRUM3_HUMAN_GENE gene gene human Homo sapiens Human fosl1_human_gene FOSL1_HUMAN_GENE gene gene human Homo sapiens Human twst1_human Twist-related protein 1 H-twist TWIST1 TWIST BHLHA38 Class A basic helix-loop-helix protein 38 protein protein human Homo sapiens Human MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH snai1_human Zinc finger protein SNAI1 Protein snail homolog 1 SNAI1 SNAH protein protein human Homo sapiens Human MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR fos_human_gene Human FOS gene gene gene human Homo sapiens Human fosl1_human Fos-related antigen 1 FOSL1 FRA1 protein protein human Homo sapiens Human MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF junb_human Transcription factor jun-B JUNB protein protein human Homo sapiens Human MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF jund_human Transcription factor jun-D JUND protein protein human Homo sapiens Human METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY fos-fzr1 1443838 n/a 1443841 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1443842 unspecified role unspecified role bait bait association association false false false 5E fos-fzr1-1 1443838 n/a 1443842 unspecified role unspecified role bait bait n/a 1443843 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5E twist1-fosl1 1443838 n/a 1443844 unspecified role unspecified role prey prey tss_and_first _intron binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1443845 unspecified role unspecified role bait bait association association false false false 6F Q15672 increases expression of ENSG00000175592 twist1-fosl1-1 1443838 n/a 1443846 unspecified role unspecified role bait bait n/a 1443844 unspecified role unspecified role prey prey tss_and_first _intron binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6F the promoter of FOS was only weakly enriched for Twist and Snail binding O95863 increases expression of ENSG00000175592 twist1-fosl1-2 1443838 n/a 1443845 unspecified role unspecified role bait bait n/a 1443847 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6F snai1-fosl1 1443838 n/a 1443847 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1443846 unspecified role unspecified role bait bait association association false false false 6F the promoter of FOS was only weakly enriched for Twist and Snail binding fosl1-jun-1 1443839 n/a 1443848 unspecified role unspecified role bait bait n/a 1443849 unspecified role unspecified role prey prey n/a 1443850 unspecified role unspecified role prey prey n/a 1443851 unspecified role unspecified role prey prey association association false false false 5Di jun-fos-1 1443839 n/a 1443848 unspecified role unspecified role prey prey n/a 1443849 unspecified role unspecified role bait bait n/a 1443842 unspecified role unspecified role prey prey association association false false false 5Dii fos-fosl1 1443840 n/a 1443850 unspecified role unspecified role prey prey n/a 1443851 unspecified role unspecified role prey prey n/a 1443842 unspecified role unspecified role bait bait association association false false false 5Diii