IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ worth-2013-2 Drebrin contains a cryptic F-actin-bundling activity regulated by Cdk5 phosphorylation. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Worth D.C., Daly C.N., Geraldo S., Oozeer F., Gordon-Weeks P.R. Alzheimers - Interactions investigated in the context of Alzheimers disease Results from the "In Vitro F-actin cosedimentation assays" some Binding Assays and Electon Microscopy data have not been included as the source of Actin used is not stated (could be rabbit skeletal muscle OR human platelets). The authors have not responded to a request for information. phillip.gordon-weeks@kcl.ac.uk J. Cell Biol. (0021-9525) 2013 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease worth-2013-3 Drebrin contains a cryptic F-actin-bundling activity regulated by Cdk5 phosphorylation. in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Worth D.C., Daly C.N., Geraldo S., Oozeer F., Gordon-Weeks P.R. Alzheimers - Interactions investigated in the context of Alzheimers disease Results from the "In Vitro F-actin cosedimentation assays" some Binding Assays and Electon Microscopy data have not been included as the source of Actin used is not stated (could be rabbit skeletal muscle OR human platelets). The authors have not responded to a request for information. phillip.gordon-weeks@kcl.ac.uk J. Cell Biol. (0021-9525) 2013 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease worth-2013-4 Drebrin contains a cryptic F-actin-bundling activity regulated by Cdk5 phosphorylation. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Worth D.C., Daly C.N., Geraldo S., Oozeer F., Gordon-Weeks P.R. Alzheimers - Interactions investigated in the context of Alzheimers disease Results from the "In Vitro F-actin cosedimentation assays" some Binding Assays and Electon Microscopy data have not been included as the source of Actin used is not stated (could be rabbit skeletal muscle OR human platelets). The authors have not responded to a request for information. phillip.gordon-weeks@kcl.ac.uk J. Cell Biol. (0021-9525) 2013 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease dreb_human Drebrin DBN1 Developmentally-regulated brain protein D0S117E protein protein human Homo sapiens Human MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEEERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEGFEGGD q15078-pro_0000004794 Cyclin-dependent kinase 5 activator 1, p35 TPKII regulatory subunit CDK5R1 CDK5R NCK5A Cyclin-dependent kinase 5 regulatory subunit 1 protein protein human Homo sapiens Human GTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR 2 307 cdk5_human Cyclin-dependent-like kinase 5 CDK5 Cell division protein kinase 5 Tau protein kinase II catalytic subunit Serine/threonine-protein kinase PSSALRE CDKN5 protein protein human Homo sapiens Human MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP mare3_chlae_protein MARE3_CHLAE protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey dbn1-dbn1-5 1445399 n/a 1445402 unspecified role unspecified role prey prey adfc_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 n/a 1445402 unspecified role unspecified role bait bait bb_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) 1445411 1445408 physical association physical association false false false 2I cdk5-cdk5r1-7 1445400 n/a 1445402 enzyme target enzyme target substrate substrate neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1445403 unspecified role unspecified role ancillary ancillary n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 1445404 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. phosphorylation phosphorylation reaction phosphorylation false false false 5D Purvalanol - a specific inhibitor of cyclin-dependent kinases Q16643 ser-142 O-phospho-L-serine Q00535 increases activity of Q16643 Q15078-PRO_0000004794 is required for the phosphorylation of Q16643 by Q00535 mapre3-dbn1 1445401 n/a 1445405 unspecified role unspecified role bait bait n/a 1445402 unspecified role unspecified role prey prey c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q16643:p.Ser142Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q16643:p.Ser142Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5G S142D coimmunoprecipitates with EB3, whereas S142A drebrin-YFP only very weakly coimmunoprecipitates.