MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2013l-1 Cotton GhMPK6a negatively regulates osmotic tolerance and bacterial infection in transgenic Nicotiana benthamiana, and plays a pivotal role in development yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Y., Zhang L., Wang X., Zhang W., Hao L., Chu X., Guo X. xqguo@sdau.edu.cn FEBS J. (1742-464X) 2013 Only protein-protein interactions imex curation anonymous-2013l-2 Cotton GhMPK6a negatively regulates osmotic tolerance and bacterial infection in transgenic Nicotiana benthamiana, and plays a pivotal role in development onion-epidermis Allium cepa epidermis A thin surface layer of tissue in higher plants formed by growth of a primary meristem. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Li Y., Zhang L., Wang X., Zhang W., Hao L., Chu X., Guo X. xqguo@sdau.edu.cn FEBS J. (1742-464X) 2013 Only protein-protein interactions imex curation i6ll47_goshi Mitogen-activated protein kinase MPK4 protein protein goshi Gossypium hirsutum Upland cotton Gossypium mexicanum MKKEMGSTKHSSSEGSSIKGVPTHGGKYVHYNVYGNLFEVSSKYVPPIRPIGRGANGIVCAAVNSETRQEVAIKKIGNAFDNIIDARRTLREIKLLRHMDHENVIAIKDIIRPPKKETFNDVYIVYELMDTDLHHIIRSDQPLTDDHCQYFLYQLLRGLKYVHSANVLHRDLKPSSLLLNAKCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDMWSVGCIFGEIMTREPLFPGKDYVHQLRLITELIGSPDDASLGFLRSNNARRYFRQLPQCRKQQFSARFPNMSPGAVDLLEKMLVFDPNKRITEEALCHPYLASLHDINDEPVCPRPFSFDFEQSSCTEDHIKELIWRESLQFNPDPVH g8c6k8_goshi Mitogen-activated protein kinase MPK6 protein protein goshi Gossypium hirsutum Upland cotton Gossypium mexicanum MEGGGPPQAADTEMAEAAQQQPQHHQQRPPQVAAGLENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVALKKIANAFDNKIDAKRTLREIKLLRHMDHENVVAIRDIIPPPQRECFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFPYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSESDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEAELEFLNENAKRYIRQLPLYRRQSFTEKFPNVPPLAIDLVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIYREALAFNPEYLQQ mpk6-mpk4 1437097 n/a GhMPK4 1437099 unspecified role unspecified role prey prey ad-tag fusion protein fusion protein predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a GhMPK6a 1437100 unspecified role unspecified role bait bait bd-tag fusion protein fusion protein predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f11a In the yeast two-hybrid system, the positive clones 28 expressing GhMKK4 and GhMPK6a grew on SD medium QDO, indicating that GhMPK6a was coupled with GhMKK4 mpk4-mpk6 1437098 n/a GhMPK4 1437099 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component fixed cell fixed cell yfp-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a GhMPK6a 1437100 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component fixed cell fixed cell yfp-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f11b These data demonstrate 7 that GhMPK6a interacts with GhMKK4 in both the cytoplasm and the nucleus.