IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kim-2013c-1 Structural changes during cysteine desulfurase CsdA and sulfur acceptor CsdE interactions provide insight into the trans-persulfuration. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kim S., Park S. psy@ssu.ac.kr J. Biol. Chem. (0021-9258) 2013 Only protein-protein interactions imex curation csda_ecoli Cysteine desulfurase CsdA Cysteine sulfinate desulfinase Selenocysteine lyase csdA b2810 ygdJ JW2781 protein protein ecoli Escherichia coli (strain K12) MNVFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATQQFYSLSAGNVHRSQFAEAQRLTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLEAMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHCAQPLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLVD pyridoxal 5'-phosphate pyridoxal 5'-phosphate 3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]-4-pyridinecarboxaldehyde 3-hydroxy-5-(hydroxymethyl)-2-methylisonicotinaldehyde 5-phosphate codecarboxylase Phosphoric acid mono-(4-formyl-5-hydroxy-6-methyl-pyridin-3-ylmethyl) ester pyridoxal 5-monophosphoric acid ester pyridoxal 5'-(dihydrogen phosphate) Pyridoxal 5'-phosphate Pyridoxal 5-phosphate Pyridoxal phosphate PYRIDOXAL-5'-PHOSPHATE (4-formyl-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) NGVDGCNFYWLIFO-UHFFFAOYSA-N csde_ecoli Sulfur acceptor protein CsdE csdE ygdK JW2782 b2811 protein protein ecoli Escherichia coli (strain K12) MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQV csda-pyridoxal_5__phosphate 1458108 n/a 1458109 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1458110 cofactor cofactor coenzyme neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig.s 1, 3, 6 1.8 A R = 0.17, Rwork = 0.16, Rfree = 0.21 csda-csde-3 1458108 n/a 1458109 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1458111 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1458110 cofactor cofactor coenzyme neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig.s 1, 4, 6, 7 2.0 A R = 0.16, Rwork = 0.16, Rfree = 0.22