MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint georg-2013-1 Structural and biochemical characterization of Rv2140c, a phosphatidylethanolamine-binding protein from Mycobacterium tuberculosis in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Eulenburg G., Higman V.A., Diehl A., Wilmanns M., Holton S.J. sjholton@googlemail.com FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation georg-2013-2 Structural and biochemical characterization of Rv2140c, a phosphatidylethanolamine-binding protein from Mycobacterium tuberculosis in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Eulenburg G., Higman V.A., Diehl A., Wilmanns M., Holton S.J. sjholton@googlemail.com FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation georg-2013-3 Structural and biochemical characterization of Rv2140c, a phosphatidylethanolamine-binding protein from Mycobacterium tuberculosis in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Eulenburg G., Higman V.A., Diehl A., Wilmanns M., Holton S.J. sjholton@googlemail.com FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation y2140_myctu UPF0098 protein Rv2140c MTCY270.28 Rv2140c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTTSPDPYAALPKLPSFSLTSTSITDGQPLATPQVSGIMGAGGADASPQLRWSGFPSETRSFAVTVYDPDAPTLSGFWHWAVANLPANVTELPEGVGDGRELPGGALTLVNDAGMRRYVGAAPPPGHGVHRYYVAVHAVKVEKLDLPEDASPAYLGFNLFQHAIARAVIFGTYEQR y2140 1427428 n/a Rv2140c 1427431 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false t1 f1 y2140-1 1427429 n/a Rv2140c 1427431 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false sf3a y2140-2 1427430 n/a Rv2140c 1427431 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false sf3b