MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint dutta-2013-1 The effect of β2-α2 loop mutation on amyloidogenic properties of the prion protein. in vitro In vitro fluorescence fluorescence technology fluorescence experimental particp experimental participant identification experimental particp Dutta A., Chen S., Surewicz W.K. FEBS Lett. (0014-5793) 2013 imex curation Only protein-protein interactions dutta-2013-2 The effect of β2-α2 loop mutation on amyloidogenic properties of the prion protein. in vitro In vitro atomic force microsc atomic force microscopy AFM AFM atomic force microsc experimental particp experimental participant identification experimental particp Dutta A., Chen S., Surewicz W.K. FEBS Lett. (0014-5793) 2013 imex curation Only protein-protein interactions prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG prnp-prnp-33 1435428 n/a PrP 1435430 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n/a PrP 1435430 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false homomint mint f1 f5 prnp-prnp-34 1435429 prio_mouse PrP 1435430 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified prio_mouse PrP 1435430 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3 homomint mint