IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ivanov-2013-1 Phosphorylation regulates FOXC2-mediated transcription in lymphatic endothelial cells. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ivanov K.I., Agalarov Y., Valmu L., Samuilova O., Liebl J., Houhou N., Maby-El Hajjami H., Norrmén C., Jaquet M., Miura N., Zangger N., Ylä-Herttuala S., Delorenzi M., Petrova T.V. tatiana.petrova@unil.ch Mol. Cell. Biol. (0270-7306) 2013 Only protein-protein interactions imex curation ivanov-2013-3 Phosphorylation regulates FOXC2-mediated transcription in lymphatic endothelial cells. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ivanov K.I., Agalarov Y., Valmu L., Samuilova O., Liebl J., Houhou N., Maby-El Hajjami H., Norrmén C., Jaquet M., Miura N., Zangger N., Ylä-Herttuala S., Delorenzi M., Petrova T.V. Interaction with ERK1/2 shown in Fig. 2B not curated as it is not possible to tell which of the 2 proteins is the interacting partner. tatiana.petrova@unil.ch Mol. Cell. Biol. (0270-7306) 2013 Only protein-protein interactions imex curation foxc2_human Forkhead box protein C2 FOXC2 FKHL14 MFH1 Forkhead-related protein FKHL14 Mesenchyme fork head protein 1 Transcription factor FKH-14 protein protein human Homo sapiens Human MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYHHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 2aba_human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform PPP2R2A PP2A subunit B isoform alpha PP2A subunit B isoform B55-alpha PP2A subunit B isoform PR55-alpha PP2A subunit B isoform R2-alpha protein protein human Homo sapiens Human MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN foxc2-pin1 1435804 n/a 1435806 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1435807 unspecified role unspecified role prey prey physical association physical association false false false Fig 2A ppp2r2a-foxc2 1435805 n/a 1435806 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1435808 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2B