MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint soboh-2013-1 d-13-01028r1 in vitro In vitro comigration in sds comigration in sds page comigration in sds experimental particp experimental participant identification experimental particp Soboh B, Stripp ST, Bielak C, Lindenstrauß U, Braussemann M, Javaid M, Hallensleben M, Granich C, Herzberg M, Heberle J, Sawers RG FEBS Lett. (0014-5793) 2013 imex curation Soboh B., Stripp S.T., Bielak C., Lindenstrauß U., Braussemann M., Javaid M., Hallensleben M., Granich C., Herzberg M., Heberle J., Sawers R.G. Only protein-protein interactions c4zzn2_ecobw hypC BWG_2464 protein protein ecobw Escherichia coli (strain K12 / MC4100 / BW2952) MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPDVGALLYGEEK The sequence has been withdrawn from uniprot. mint c5a0q5_ecobw hybG BWG_2708 protein protein ecobw Escherichia coli (strain K12 / MC4100 / BW2952) MCIGVPGQVLAVGEDIHQLAQVEVCGIKRDVNIALICEGNPADLLGQWVLVHVGFAMSIIDEDEAKATLDALRQMDYDITSA The sequence has been withdrawn from uniprot. mint hypc-1 1435447 n/a HypC 1435448 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false f1a mint hybg-1 1435447 hybg HybG 1435449 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false f1a mint