IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ozkan-2013-1 An Extracellular Interactome of Immunoglobulin and LRR Proteins Reveals Receptor-Ligand Networks. in vitro In vitro solid phase assay solid phase assay tag enzyme assay tag visualisation by enzyme assay tag enzyme assay Ozkan E., Carrillo R.A., Eastman C.L., Weiszmann R., Waghray D., Johnson K.G., Zinn K., Celniker S.E., Garcia K.C. The bait/prey relationship for proteins only described in Fig. 4 could not be ascertained. Bait protein construct contain a C-terminal Biotin tag. kcgarcia@stanford.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation ozkan-2013-2 An Extracellular Interactome of Immunoglobulin and LRR Proteins Reveals Receptor-Ligand Networks. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Ozkan E., Carrillo R.A., Eastman C.L., Weiszmann R., Waghray D., Johnson K.G., Zinn K., Celniker S.E., Garcia K.C. The bait/prey relationship for proteins only described in Fig. 4 could not be ascertained. Bait protein construct contain a C-terminal Biotin tag. kcgarcia@stanford.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation ozkan-2013-3 An Extracellular Interactome of Immunoglobulin and LRR Proteins Reveals Receptor-Ligand Networks. in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging immunohistochemistry immunohistochemistry Ozkan E., Carrillo R.A., Eastman C.L., Weiszmann R., Waghray D., Johnson K.G., Zinn K., Celniker S.E., Garcia K.C. The bait/prey relationship for proteins only described in Fig. 4 could not be ascertained. Bait protein construct contain a C-terminal Biotin tag. kcgarcia@stanford.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation q9vfu7_drome side-IV 14372 BP1073 CT34011 Dmel\CG14372 CG14372 Dmel_CG14372 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHHEETYQVVCRLIEREELEDREPCCRKKPTAPHPFPSPNVWRQLLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQERDDAVYMVLWFREGDGEPIYNFDVRGRQFGQARLWSSPTAFGTRAHFSSTTHPAQLKIDNIRIEDEGVYRCRVDFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFSEGNDIVLSCEVSGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCVASNTNLTPPNNRVVILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLKKLTKNFNEPDNQSLSILTFTPGREDDGKYLTCRAENQFIDGSAIEDKWRLIVHYQPTTTLKIGSSLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKELQHNISAGVILSDQSLVLQSVSRASAGDYTCLAVNSEGKGPSNPVTLRIRYAPICATDHEELLGALKHETLPLKCEVDSSPPADSFQWTFNSSGEQTELPARLHSSETGMSRLNYTPSTDLDYGTISCWAKNSIGTQKSPCVFQIVAAGRPFPLQNCSVTNQSVDSLQVDCLEGFDGGLPQGFMLELVELNTLRLARNITVSHTPVTFVIDNLDQAATYRMVIFAVNAKGRSEPTIIDDINFKGVAKFTGASTGLSMPLSPFLAGLTLFCGLLFAIFCIMLAAIYRRISNRRSDSNLKVAKHTQLTIPADCQLDPLHPGVQTDGSGNHQPHHSLLPLNCDGRNAVDCGALGDVGGGGVGVGLDGGIKGSSPIGLVAMPGDTLRSNARNRHSPMADQADIDDTDPDVIPNQYEKRPLKSLVSPPGFASPSNRLMQRDYLRETELTKGGSDVGMGAAEGLSSIGLMSSSGNEVLHYTFRPSKQISYATLNKKGITTCSPPLGSLNYSVSTSTPTSSYHLTPQPMEVSLLSPNNPSVTSSLSEYRFRTGPEIVTTSNRIQESCI q24591_drome 18w CG8896 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPATSSIITIIAVAACLLLLVADAHAQQQCNWQYGLTTMDIRCSVRALESGTGSPLDLQVAEAAGRLDLQCSQELLHASELAPGLFRQLQKLSELRIDACKLQRVPPNAFEGLMSLKRLTLESHNAVWGPGKTLELHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTEVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRLDKNFLTDINGIFATLASLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVTTLDASHNRITEIGAMSVPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNALRVAPVSAEKPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPHVVDLGNIECLMPHSRSAPLRPLASLSASDFVCKYESHCPPTCHCCEYEQCECEVICPGNCSCFHDATWATNIVDCGRQDLAALPNRIPQDVSDLYLDGNNMPELEVGHLTGRRNLRALYLNASNLMTLQNGSLAQLVNLRVLHLENNKLTALEGTEFRSLGLLRELYLHNNMLTHISNATFEPLVSLEVLRLDNNRLSSLPHLQYRHSLQGLTLGRNAWSCRCQQLRELAQFVSDNAMVVRDAHDIYCLDAGIKRELELIGNLANGPDCSDLLDASASNISSSQDLAGAIGCPCWPAVLVLIFLVVVLIIVFVFRESVRMWLFAHYGVRVCEPRFEDAGKLYDAIILHSEKDYEFVCRNIAAELEHGRPPFRLCIQQRDLPPQASHLQLVEGARASRKIILVLTRNLLATEWNRIEFRNAFHESLRGLAQKLVIIEETSVSAEAEDVAELSPYLKSVPSNRLLTCDRYFWEKLRYAIPIELSPRGNNYTLDHHERFKQPVSPGMIFRQAPPPPAYYCTEEMEANYSSATTATPSPRPTRPGGAARIVDSMPMPMRPPSEHIYHSIESEYSAYDQHEALSMIPTGLMHQHQQQQLRLHQQQQQQQQQRLLQPQFRAMPQQAIPAPSAPVHLRSGSGLSQASTSTQSTAQASTSAAAAQQQQQQQQQQQQQQAAGSEAANKNGQAFLV q9bmg9_drome beat-IIa CG14334 BcDNA:RE17794 Beat-IIa CT33965 Dmel\CG14334 beat IIa Dmel_CG14334 CG14335 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLELQLCGDLSAGDLSEIPKMGHQRATDTGHRQIRSHRKSDCRTFPARCLLLLLGVLLLSMELVECALRNVNLIIEPPAVRRGQHVVLRCMYDLDGAPLYSAKFYRGQLEFYRYTPGEFPNTKVFPFPGIHVDVSSSNATQVLLRNVGFGLSGNFSCEVTADAPLFSTATAVDTMQVVELPEKRPQVFTEHTRYEPGDVLRANCSTPPSRPRAELTFTINNMVITHVDTEYIRTIDNLIATRISLKMQLQGIHFSSVNPAIYNNVYGLNSVYGHGGPVYAPNSNPGGLLLRCSAQIGDLYQEYKEIELGTPQKDPVPARVTLSSDTSLKNFFSSYFSTSASAASRLLPGVYMAPLIMAMLASLFRLIEAAFEPCDASSQDPQSQTGHSMEHSKERREPKERPALVSSCSVSKASRQQLAWPGSRTESLRLA q9vb35_drome side CT33527 CT33528 Dmel\CG31062 Doe Side doe Dmel_CG31062 CG12510 CG13973 CG13974 CG13975 CG13979 CG31062 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQLLLPTSGMPTNTLETETPAMQTTYWPRQTGNSKSKSNTNCKCNINTHRKSRTRCPDNGKTIWAVGFTLVLLTCLQQLKSVSADEESQDFQKNIPARLVWAALGKTVELPCDLTPPTSQDSVKLLLWFKDTTGIPLYSLDSRGGNVKLAPHAAIASDLGQRLFFSIGDNPKDSRLQINDVKPEDGGVYRCRVDFFNSPTRNFRHNLTLVVPPEEPRIFDAQGKEISQMAGPFREGYELFLCCQVRGGRPPPKVTWWRDDTELIGTSHTSVEEGATVMVNQLLIGTTTRDFYGIRIECRAQGTRLVDPVRKDVTVQVYLKPVRVKIATPNELLTAGQPMPIRCESWGSYPAAKITWLLDGEPIRNAEVTVHSDKEDGNITTSILTLKVTSENDNAELTCRATNPWFSGGAIEDKRIIRVAYPPTVSVHLANEDPSRLVTRAEGQNVTFKCRADARPPVTSYSWFKNGMRMSGESTEIMHLTQLERESAGAYACGATNTEGETRSSSLTLKVQFSPRCKSGTEQTSIGAVSLHSILVKCEVDADPPDSVRFSWTYNNTRNVSPVLNSRIQSNGLASTVTYLPQTDSELITLACWASNAVGRQTTPCLVHILPANTPEAPKACELRNDTVLEVVCVAGSDGGLSQYFMLEVVGGDPLYSGDPGGSAGQGRGQFSEAIGLGDNEISTLNDQATSAPIFRMQENSPQFRLNNLEPGREYQFLVYAVNAKGRSEPPVVIENVRVAAQLGPYDESILSEDPTPAETTHHGGGGVGGSGSSSGLGTGASTGSGPEKQSTLLILAAVVVIGAVVVTSIIVAGIVVVCRHRPRPPEPQEVRKSMRPARNDVPSMYIEEDELNELEEGGGRAADIRARVAPPNSHLCGGGGMPMPGGVGSSGGAIVGVAGPHHYISESFIQYAQPSLNDPDLILPRGELEFTTLDPTLK q9vel7_drome beat-IIb Beat-IIb CT13620 Dmel\CG4135 beat IIb Dmel_CG4135 CG4135 CG14337 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MWQTLSTFSTSLRAAAAAVAAQPAATCNCSCKLENAEMHSHMLPSAEIATTAVRRCCCRTKITRSNSSNYSCNYGSNVIQWLLLLCLFCDFGQAALRDVNLLVEPPAVRRGQSVALRCDYQLVEAPLYSIKFYRGQMEFYRYTPGEYPPTKVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADAPLYSTATAFAQMQVVEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNIPVSIPFTEETQYIRTVDSLIASRLSLKLQLQATHFVAGLSAHGNGNGNGNGNGNGNGNGLANALHLGGGGGGAGGGGLILRCTAQIGDLYQEYKEIELGTPQKDPVPARVTLSSGTGLRGFLETYFATSSGPSNWRGSAGVVAIFLPTALAQLITGS q9vs29-6 Down syndrome cell adhesion molecule-like protein Dscam2 Dscam2 CG42256 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MWISSRFFVILLLLNLDNTCSEPFEAHLRGPGFVMEPPGRVEFSNSSGGWLDCSASGSPQPTVDWVHADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDVHNTIYRCIASNSVGRIVSRDVQVRAVVAQAYKVDVEVLSAARGCTAILRCVVPTFVKELVRVVSWVHEPAIYIYPSLQGDGKFHLLPTGELLIHNLQESDESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGIISPSVVEHTAHVQVSQDEGAVLLCVAQGCPSPEYSWFTHNGAGPLPVLSGPRVRLLGPILAIEAVTGEDSGVYKCTAGNVGGEASAELRLTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYKDGRQLPSSGRVEDTLVVPRVSRENRGMYQCVVRRPEGDTFQATAELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADPLFVDQWQQIEVKDPPHFNAMIENLKPATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTAYNFTSVSGDGDGGNGELLLSGLAKFARYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEEDVPEAPADIKVVSSSSQSLYISWLPPNEPNGVITKYSLYTRVVNGREELNNEKRSLPSQQAYYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARIISFGGPVVRPWRSTVTLPCTAVGKPKREWFKSDVALRQGGLHNSQLLDSGDLIISSLQLADGGNYSCQVDNGIGTDRLTHTLIVQVPPTAPVLYVTSATSSSILMHWKCGFTGNAPITGYTLFYRRANGNTDEMQLSRHASSHELKGLMCGSTYQIHLSAQNKVGTSPTSTILHVRTQGQSPGHPASTALLAPNSTSLLVRLHSWPDNGCPLLYFVLQYRAVTDDPDAEWVLVSNALKPQRRIVINNLQPSTLYQLRMEAHNVAGISQAEFNFVTLTKDGDPPPPEIMHRGRSGQTTVIFANINLLIPTIAAVSGMFCTIIMIIVCYRHMLKNAPPLAEQSQIQKESLENRANSEAAQRERYYATIHKVSMQNNDKIPETSEDISPYATFQLSEAGGNMSQPHHGGPANTLLHSFMYHERALAEGCSSPPPAASKNRRRHSRKTEPESEESESDQDQLTSSRTESSNQHEGKIKHNSRLIQHFPNHNISITYL No experimental confirmation available. q9vs29-4 Down syndrome cell adhesion molecule-like protein Dscam2 Dscam2 CG42256 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MWISSRFFVILLLLNLDNTCSEPFEAHLRGPGFVMEPPGRVEFSNSSGGWLDCSASGSPQPTVDWVHADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDVHNTIYRCIASNSVGRIVSRDVQVRAVVAQAYKVDVEVLSAARGCTAILRCVVPTFVKELVRVVSWVHEPAIYIYPSLQGDGKFHLLPTGELLIHNLQESDESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGIISPSVVEHTAHVQVSQDEGAVLLCVAQGCPSPEYSWFTHNGAGPLPVLSGPRVRLLGPILAIEAVTGEDSGVYKCTAGNVGGEASAELRLTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYKDGRQLPSSGRVEDTLVVPRVSRENRGMYQCVVRRPEGDTFQATAELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPSIEPFAFQEGLAEGMRTRTVCGVSRGDPPLKLIWLKDGDPLPDLLGANVTMLDQYSSLLSIPSLSATHSGEYTCVAKNPAAEIKYTALLQVKVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADPLFVDQWQQIEVKDPPHFNAMIENLKPATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTAYNFTSVSGDGDGGNGELLLSGLAKFARYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEEDVPEAPADIKVVSSSSQSLYISWLPPNEPNGVITKYSLYTRVVNGREELNNEKRSLPSQQAYYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARIISFGGPVVRPWRSTVTLPCTAVGKPKREWFKSDVALRQGGLHNSQLLDSGDLIISSLQLADGGNYSCQVDNGIGTDRLTHTLIVQVPPTAPVLYVTSATSSSILMHWKCGFTGNAPITGYTLFYRRANGNTDEMQLSRHASSHELKGLMCGSTYQIHLSAQNKVGTSPTSTILHVRTQGQSPGHPASTALLAPNSTSLLVRLHSWPDNGCPLLYFVLQYRAVTDDPDAEWVLVSNALKPQRRIVINNLQPSTLYQLRMEAHNVAGISQAEFNFVTLTKDGDPPPPEIMHRGRSGQTTVIFANINLLIPTIAAVSGMFCTIIMIIVCYRHMLKNAPPLAEQSQIQKESLENRANSEAAQRERYYATIHKVSMQNNDKIPETSEDISPYATFQLSEAGGNMSQPHHGGPANTLLHSFMYHERALAEGCSSPPPAASKNRRRHSRKTEPESEESESDQDQLTSSRTESSNQHEGKIKHNSRLIQHFPNHNISITYL No experimental confirmation available. q9ve49_drome Dmel\CG7702 7702 CT23351 CG7702 Dmel_CG7702 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKHKLLLLFLAGAALLLATEVRSQHEDIPYQPVSNICQTCLCLSTQDVDHRTHFNLDCSVRNFEHILARWPEQFGSQAIASGAASEIVVSYSGNRIKLLQQLPATNASLTLSCRHCGLQDLQAPLFMDVPNVQALYISWNDITDDALVPDLFRGPFRNTRYEPIGLRDLDLSHNRIVRLDRRLFEHTPHLTKLNLAYNKLSSLDEATTASIGSVATLQRLDLSHNGLMTLPAQLFSKLTSLRFLDVSGNEFSTMPASLQLLGKSLVQLNLAGNAFLSLKENSLQGLVSLKRLNISSMPSLRSLEKGALNLPALEHLDCSRNSKLERLELADLLSSRNLSQLDLSWNALTTLVINATGSSNNSSNSTNETWPRLRRMSISGNPWYCSCELFKALELIGLNHIDREWDGTEARCETPYLLAGSPLSNLTAERICKMVIPKKYREVDEEPPRFLRRHYIILTAIIASIVLVIGLVIGFVVVCVRRRLKGSDYGVQPIRYTSVRGSNLSQFSQLQPVSVASKFNNVHAGSSSGVTTGAANA q9w259_drome 13506 CG13506-RA CT32874 CG13506 Dmel\CG13506 Dmel_CG13506 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MIKARDSTRLLLISLLIGQLYVSCAGSPIDADVKGTDYQDDEYEYGDDTDDDDTQIIDVTKNHAEQEAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCMLNNSILLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNEVKVHVSYNPETPQFEDMTVEGNKVTLHWLVRSHQLLSEAMLDYQLTGSYTWSTVQVLETHRHNNTDNIWKITHQLELSRGVWHARVKTKNTKGWSHFSNDHVFEIPEDSEVDKDEEVELPPDEIVQAGIMPMSKGAASSMQRLNVGVILLAALLLRVRL q9w128_drome CT15357 4781 Dmel\CG4781 CG4781 Dmel_CG4781 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MARLEVIRGLTFALLLTQLLAAHVARAEVIDAEETDRFCYPESSKNSRRSCECSNVSASPWGNRALRIDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNISQLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWNRRFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAPLKELSLRRNQLKRIPTQLPETLLRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVLETLSFQNSRQLSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQCDCELVWLKQLPVQTNGRCYKPARIRGMLVTSARGDAFSCDTWPRWAYGLVVLSLIALSAAGIYLIVMGLRPHRGVTMRRKVGAGSPYARVTIEPNRQENPH q94534_drome beat-Ia beat CG4846 beat-Ia-RA BG:DS00913.3 Beat Ia Beat-Ia CCT CT15567 Cct Dmel\CG4846 TRiC beat Ia beat1a l(2)35Ea l(2)35Eb l(2)br47 l(2)br48 tric Dmel_CG4846 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRFPQNAYQTALTTILLALTLEMTAALRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKILRDARNDMETAVVGIHFVVTDQHFDNGKLKLRCSAQLHDVYWKTTEKIILETDLFPKHGNGANGNHVNPDDFYDQYALHEDHLHNKKNSYLTQLQGEEDDGTEGGLGDGGAAWRGAGSSSSRLSPSSSQSCWMVGGSLMAVLSWTLARQLVSPLQAMMTKTGGATCNMSGRCASRRTRAHGMRVSATKQKQKQRQMQQEHRKSCLRVSKSSWKGRGYVCGCGFGRINSRCIRQLT q9vcl1_drome Beat-IV Dmel\CG10152 beat IV beatIV Dmel_CG10152 beat-IV CG13823 CG10152 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKYTNDTRIIVFICCLLQGFAVGLRMIKVSIPAYKLRGESAFLECQYELNRTHHTVTGLQSHSDHAHGHNTHAGEFHYPDGDALEDERSSYRSRMRQSQRQHGQRPRQREPIAMRQYQSQQSHQQLPAPPEKSPYGHSVYRGSAASGYLGAAHVGASTHSGSVSVSNGNSNGVPAAYMPDFDRADSFDDSHDREEEEDEDEEEQPEEGEALYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEVSAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQPILDEHYLHKYNDIVHKHGLITSTLGLQLPLEPRHFHEGDMRVKCLASISPVLWKGGKESVLQRRPGIIDNREAMLLGE q9vh85_drome side-VII 12950 CT32101 Dmel\CG12950 CG12950 Dmel_CG12950 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MELLLLFMLALQLIESSIGSKDVPIHQIESIVGENIYLPCNVTTYDGDEPVLVLWYRDDKGTPIYSIDIRAGVSKAPKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRVDFLKAQTINSRIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDIVSLKCQVIGGYPTPTISWYRDGIEIPCELSHLAGGKIIECEITLPSLGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSAGSRPPAVITWWQNGIRLEKTTETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLDIQYVPEAYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEWRHNEQPLSHNISLGVIISNHSLVLQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQKKVYGIAKQEDAKVMCTVDANPREVEFSWTFNNSAESIDVATNHIIRSGTTSIVTYTPITELDYGTLLCLASNKIGKQRVPCVFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGFNGGLPQSFNLELLDSYTQEIKANITSTIPKFTVPGLSPGSIYRLNIYAFNTKGRSDPAIVNAAMLRMPEKQLTSEQTHNLRAELLFSPVMSLTIGLTLAVLVAVLAIILALRIPCTASSRRRQKELSNENISRDESPGPSDKSSGSKEVDDCDEKNPDVVPESIEPDEQAESIRKRQQISTIDTNRSPNRGIFVNEQQHLTAAEISLRASHGIGYCTLRSGMHAQAQSSVGEISINVTPHVYSNSISQCTLPRQSSQNVWNNYNCNITGARPTSTFHQLTFPQGRVNVGGHNPAQPLHGHAPSPSQASNSSMASSTNTLPQPHPHGRTIAMHHMNQAQCGRVCIGIASDGIHSAEQNVSDDEVTVQTPLMIKRDSTV q0ki85_drome side-VI 34114 CG14698 CG4695 Dmel\CG34114 CG34114 Dmel_CG34114 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSFTGPILICLIMGAITHANSHEHADGFKPDGEILRVLVNSSAQIKCDVGSSQADDKVLLVVWYKNNLPIYSYDTRGAHAGTPSHWRDEEVLEDRAVFRTHKEPAELIINPVKEKDAGNFRCRVDFKLSQTRNSNVNLEVVVPPTQPIIFNERRLRIDSRAGPYEEGGSLEVTCVVYGGSPPPTVIWLMNGQLQNSVVDYTYDGAINSKLVVRNLSRIHQHAVYTCQASNFHKKYVATNITIDLYLRPLLVEISFNNQPMSADRKYEIECQAIGSRPPAKITWWMGNLELHGHSQKVSEDGNVSTSVLSITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNLNPEDIEEGDDVYFECKVHANPAAYKVVWKHNHQIIQHNQRAGVIVSSGDLALQGVTRHQAGNYTCTASNVEGDGDSNVVELKVMYKPICRPDQKKIYGVARNEAAEIVCEVDAFPPPENFKWSFNNTAETFDMPQSGFRPHSAQGSTLTYTPVKEMDFGTIMCWADNNVGQQKEPCVFHLIAAGKPEAPTNCTVVNQTSDSLEVYCIEGFDGGMRQWFLMEIFDQHSGQLQANISAKFAALSVTGLDAGRLFRIYVYAVNGRGRSDAIALDGYTLKAAEKQTVALTSYKGSAQSPDNFELTPILSIGIFVGILVAIVCIGIGTIAALKLRSHKHQQQQKFVHPNAKFSRPGNLQIKDKISLPLSHSEEMYDEKNPDVVPYNEVDGEYKQKSATQTPSGHLSTTSEVEISCKPGSTSGTGIVQANSADSGTYQSSKDDELHYAELSLTNMPSGSSGASKKGQPMGGVGVVQHVVQQQQQQQQGQVQHPHQLLGGTLPHGSSMRKLLPTIPATATLQRHKPNAGGMQHPHQHAPPPTYDYDYFEEPTIYAQIDAYKTMQVDTGVVVAGVGAGAGSGVNGAGASISSPGSHGTPSTVSPGTVQMYTLPQHPGGYHTLPHNHHAQQQMAGGPQNSASMMQMMQQQQQQQQQMHHHPASNMPPSYQQHQQQQQQQQMAHGQMLVSSNSSGLASTTAAVASPSSSLSGLSGVGKSYSREIVTVRTPLMYSQQESCV q9vg24_drome Beat-Va Dmel\CG10134 beat Va beat-Va beat-Va-RA Dmel_CG10134 CG10134 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDYGWLMFLFIALLIDYPIAYALFVTDISVPEIVDFRDNVTLSCSYDMRGHTLNSVKWYKDHEEFFRYSPLTSPIYMTFDVAGLQVLEGKYVCNESSCRLDLSLQGAKSTGLYKCEVSGDAPHFKLADKADNMTVAALPQNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYINGEQPLLGELYPTTDTSLAAHDYVLRRQRLQVQFFLQGQRFFQAGKILELKCVAEIENYPELRREKTLSASLSQYDNFNNQMPLRHANANSGSAQRSILCGRTSLISAFLAAILLIHCLRRPS q9vg19_drome Beat-Vb Dmel\CG31298 beat Vb Dmel_CG31298 beat-Vb CG14385 CG14386 CG31298 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDLGRWLLQLGVHMLLVVRRIQCLRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEFFRYSPLTPPTYIPFAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANMTVEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNGIKVSLVDLLPSFETTIVAHGYSMRRIVSQLNFYANEPRFHQLQLQKLIQQKRTISPARLGLELRCVAEIDRYPHLQREGTMFAQLFRDDIDQKNQKLINSRSGATPNSQVQHLLLVAISMTMTAVRLFTPLTFQYGARKSARYKMAAT q9vg28_drome Beat-Vc Dmel\CG14390 beat Vc beat-Vc beat-Vc-RA CG14390 Dmel_CG14390 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSLLRLLGALLLATFNGMAPVPAEGLHLSNLSVPRIIDVAQKAKLFCSYAMGNRTLNSVKWYKDGLEFFRYSPLTPPTTNWFPVKGVTIADGSPHCNQFICNVELEKLTAHSSGQYRCEVSGDAPEFKLIDQTANMTVGVLPKFDPFISGVRHAYKYHDYLEANCSTEMSSPMAKLTWYINNKTAPGHSLQPQINEVSRNVDGFHLFASHLHLRLHLDDQRFISKSEMLELRCTADIMGLAAVRRESRVRTTILALRDAGTKQRLTENGSCMTGQPASLAAWLLSLVHILRWHSTQS q7kuk9_drome CT39634 17839 Dmel_CG17839 Dmel\CG17839 CG17839 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLRLLLVHIITICVLITIVKCGVPIGTGGPSIILESKDALLTCVVSDNSSNNTVIWKKGDEILTAGTVRVTKDHRVRILHDENPKGKNLETGGEVWVLLIKTLKPNDSGAYICELNSDPVLRSIHILTVKELHSSTGGPGNSTDTSTAESSDVFLLPPPLDAQDNRSFWRPSQVPPLVTHDFTECCERANVSTQCMGFCNVHNILDGTTGIDPEACERDFPGIVRCMADGRNHVPCCVDKQIPDLCQDMCRGEYTPFTDKLKTRVSCVQHTLSGLQCILKGVQLIPSSPTFVTIENVSETSVTIGWTAPDKLADRVSGYTINLTTLHSFDEDELSGEIVHRTASDSPESISLYSVPTNQTQLTLSNLSPLTMYAVIVTATNEFGSSLPTERLRFFTHTSASAAESKAGTTDKQAMPQLPDTRQCCEDNGMTHRMCLDKMCDPQKTDQANLPDFMVCAPWSNITFNCLANNIDHTPCCRARGIPSACFPLCAGKLTSLDFSLFKCLRFMSEYNSCLFQGYGVLADPPSKLRTVAKTDSFVILDWNKPKRLADTVSTYHVKFRRLGVGDDYLTVEKRQPPLILEGLESDIYYEFYVVSINAYGKSEASPRLITRTLPAEPVQQTAARYNMTTCCQASGLLPQCAPLCSYNIRLSDIERLGPACRAQMPILARCAAGGRDHSPCCSRRGVINACMPLCRGVMPLALTTKSSSASAAAAATSSSSGATAATSASATSNSNAAGAPSSSSSSASSGTSSNVPDCLSYAGNILQCFEEGTQNIPGPPEDVHATFVNQSSVSLAWTQPDVDNSNSSSSGNASPGDMITGDELAAGAVDPANAGKDVPNAGDATSGTTGTEDIEFIVQYGKVNNMTMYETVAKLENELTTNETSIDLTNLDANALYRITVVTRGKFGTSLPASMLLLNTTDQQRTGEAWGAPSPPHSLTVVAHSATWMQLTWQPPEYAHPHERITYRVYHKAMRAEQFIKIETKLAWLRMNNLKPSSQHVLYVEAVGERGDSLPSETLVAWTDPALPAFVDPPTVHPADNIPEGGSMTILCLAFGNPAPTISLYVGGHLVRQDASRHMVTVIHNVSADMEHVSCYADNGYGVPMQATRRVNICYPPKIQAAGITVANIGDEIELRCTVDSKPAPKTIFWREKDGRVPVINGGNYFISVKANESRPSIYTMSLRISKLQANDVGDYFCHADNPFGATTTPVSVRIRNTPALNHNVSECCAAQNVSMACRSACSYYVDFDAIADRPECIVDFDKLMRCAADGSDHRSCCADEHVPRKCLNWCRGESVRSKEICSLQYARTIVGCFEKNRDRLPGPPENIVVSVVSDSEVNVRWDAPTKNPNAVDGYRIFYHEAAILPPTSSSSSGSPSSDSGSSMENPGMDTLAAMNNATSMGNSNNAMAALEIRRIDVKDTTISINGLKKDVLYELVVKAGNSYGASVLTDPIRFTLGEHHVTSATSSYSSAVGTISGIVASILAILLAAAAIVFYRRQRSSYGKSANGNVAFENPTYTRGLEQVQLPTVTSAITTQNGNHHGMSSSNNNGSSNSHSHGRNGIAATMTTSTTTTAPTAAAAASATSAGVALTGNRQHQQQQQQQQQQQQQHKSAADAAHHFHNPLSNTQCNEVNPTIYEELKLGQEGAGFKKLVP hig_drome Locomotion-related protein Hikaru genki hig CG2040 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MWSRQRMRHKPLWALISLTVLLLVLDKSNANTEPVETSTTSEPDASPGCRAPDVRFTIVKPEATTEQPLAKFETTQIYLPEDFTTADVEFVDSVPRHPNENHAAVINPYSLDLGDDHLHVGDAAASLVGDDDLGDEDEDHHGDPEDKRLNANRKQGKRRRAGSGRRRRIENENGQTGRGRGSRYKRHAILHDTEASPETDRWAGSKLAAEGDVYYVHIADILKSREPNRELKSKLHKLKMKARLNKCLAEGGKEKCTRLLKKKPKKKVVEKEQTLKKEKKFPKEEQSKEKVPENGQTPKEDELELDHPETAAAHHRRRGDSHAAELDQRDRSPRWRRRRSTEFKGDLGQLPPESGIGPEPEPLADQDLKDLQQYGNQSSSARVALLWQRVKRKSGKTTGALSRPKGGGDSSSKTTSRKDKGIYDEEAGYTPIHPDDPEFDEEEEEDEEVDILQQFTEVSEIRFPGEIGPMGDRRLCKIRCVKGKWVGPLCATNEEDDNGNVKFQPLYKSCHVNRIPSHLLLSYRNISVTPIPPNRGWRKTRLSKSTLLSNTEINVGWDLPHGHSLQARCQELGIYKLLGESRVLCSNGLWAPRMPSCVPTTVLTNYSEDSAPSIRIKIFNGSHSFEPSGVMAVPPHSTVLMDCMYPRVRGTPEWSWTSWYMQYSTGWSPAQEEKAVRYRLSIKNIENNDSGTFTCTSPRGLTNSIAVVVATSTCPQLTEPLAPLKLRLEGNKLGQRAHYECPEGFRLDGAWNATCLASGNWSSPTPTCHAIQCPRLELDDPHLSLIELNTSAWGRAVFKCQWGFKLTGPAQLDCEPSGVWSGPVPRCKVIQCVMPVAPLNGRIGGTSLSQRRLTVGALVTFSCNDGHSLVGESSIICTENGQWSHSPPFCKSQCPYPGDPPNGLIAPLKFNYDAGDYLSVQCRPGFVQSYEGPPERPKCQPDGRWSGPMPKCKSYEEV q9vdd5_drome 10824 CT11359 DIPc Dmel\CG10824 Dmel_CG10824 cDIP CG10824 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYVRNCLPFLCSYLLISLAATATTDEDADADVDSGSSRIVLVSSLEGHCQTEGKVTSCRGFEFAGEDEKATFDLPTEVRIAEDGTTYEVGDEEHSRTLIFENCTFTNFPLRLFYTLEVSELDMRGCGIRFIYWENFSIGADKLVILLLSDNHIEVLPTKTFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENRLEALAADVFAGLKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSNNPELVVLLLNINATNLTARNCSLDRVNLYGSVTNVDLSDNRVRELYFPASEALEHLVLRNNSLVQLASLSRVPRLRHLDVADNPNLGQLPDGWRTPHLEMLVLRNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFPTLTQLTHFYIHGNNWNCFSLRNIMDVLIRANGIAYTVDNYDPDFPGEYFHGIACMYRLPEKEGVDSSSSSEISASVESSPITSSSDPSEVDKLRDELKAVVQHFDSKFDLIFSKLAQLNEQIQAFEVLNKTVWSQVTLSV q9vmn9_drome 14010 CT33567 Dmel\CG14010 Dmel_CG14010 DIP-eta CG14010 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQSNFCQCRKQTCALSVILLLILMSQQCYPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKLYRIPPNAVNYVENFEARHKGKKRTKSSESHHPARAQEHSGEDMENPGKRKADLSLGAESIDSIYGNSAAGSRRRQDLGGVLLLLLPVAVAVAMSLATAGVMRETQMTLPPQTLTHV q9var6_drome DIP-gamma 14521 CT34248 Dmel\CG14521 anon-WO0140519.196 Dmel_CG14521 CG14521 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEKLLQSTLFVILIMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASASNDDHLNYIGGLEEAARNAGRSNRTTWQPLLAMLMLLWMRLSLRTGGA q9vmn6_drome DIP-theta CG31646-RA CG31646 31646 CT33566 Dmel\CG31646 Dmel_CG31646 CG14008 CG14009 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKIKIFPLTADAATIAARRQRRRAAGKLQRKREMPEISSRLIVATATAAVVSIICLSLALPGCAAQESDDEGELHHLDQMHHQHQDFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNPYNFNPGNSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRDHHQQQHHQQQQQNHGSDHGASYRSDGKSPHLTNHDAKSLTDDLDRMQDLKGWASRLSPISPILGLSMILGVGYLGPWPG q9vlf0_drome DIP-zeta CG31708-RA 31708 CT32337 CT32338 Dmel\CG31708 Dmel_CG31708 CG13103 CG13104 CG13105 CG31708 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLPPSWHLIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPSGSKTVATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNPSMAIAWLFVVIATLLLTIRSAVGSSHSLSLC a8jnc7_drome DIP-delta 34391 CT15465 CT35147 Dmel\CG34391 Dmel_CG34391 CG15214 CG4814 CG34391 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MFILTVVKLLLIALNIFPSRFTNRRIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSALPGGVAGNSLSSMGSKGSLAIGKSTFYTERPPNEYAASSVAGLLLHRALLFGSGIYLTLL b7z153_drome BcDNA:RE23430 CT34319 Dmel\CG42343 pp-CT34319 pp-CT34320 pp-CT34321 Dmel_CG42343 42343 BP1062 DIP-beta CG12564 CG12565 CG14583 CG34019 CG42343 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMNLLVVKESGERIADISCSQEHTTKFSPKLSQVAKHRKLAQLEIASGSGLVGLGTGTGTGSGCGPAIRWQLLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRAPDQHPASGSDQLLGRGTMRLIGTFLLALLVLFTALAEAGPTTLSCRTKGGRQKKAKETSWNGRRARDGREDGHAAEWRQCWERSALSWRRSAPPELDYYSLIQL a4ij70_drome DIP-epsilon 42368 Dmel\CG42368 Dmel_CG42368 CG13981 CG33295 CG9508 CG9511 CG42368 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAYHLEAISSFLYVGLGCLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEIDKSKQKLTGSSPKGFDWSKGKSSGSHGNLMASSWPLICCILALLTTHSCG q9vr83_drome CT3673 1504 Dmel\CG1504 CG1504 Dmel_CG1504 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MCNSWLVLIIALSVVVCLWNSQQTETSKSCPAECICLSQTQVLCNTGGLEQIPLRQLPATVENLALTKNNFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQNLSTILLSHNQIQRIEGNAFAGTSNIKLILLTNNPLIRIDSSAFSSLTNVGHLILPSGIRSIEQDAFFGMDTVGLLKLAYMDLKEVAPFTFRGLSNVLLLTLQESDLGVICADAFTGLTQVETLQILNNKIDSIEELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGVEHLQLVSNHFPCGCHIHTLLDGPLAEGAHNLTDFLQKNYCISPLEVNGRVMSELDIDSIGRCSDQLTKGNLGSSAASLALGINSMLLIAVASCAEWRHVRLLANRLAQLLGHVAWRRRRKRRKGN q8t603_drome dpr1 dpr CG13439 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSLPSRANFGLLNWLIGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQHFYETGCGYLHAAAAVAKSAGLGPPKRATLTTSETGISAAEVASAAGASAAVASTLATCNMLRERPAAIRCLS q9vt83_drome dpr10 BcDNA:RE37920 CT33762 Dmel\CG32057 Dpr-10 Dpr10 Dmel_CG32057 CG14158 CG14159 CG32057 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLTLWTALFCCLTGLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVLLEACSSLLLQSGGGGGCPGGGSPAGGMPTRVREIREKPLTNSLLDPKIPSTTSAERVNNGSRNAR q9w4r3_drome DIP-alpha CG13019 32791 Dmel\CG32791 Dmel_CG32791 CG13020 CG32791 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPVSAKRLLRNFQFTSCDRNGKMLIHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGGKGGGAGGSLDADANDILKQKQQVKVTYQPEDEELQYGSVEDFEAEGGEGGGLTPLSPHVYYTSGNKPATHKPGNSGGNQHLHQQHHHHHHHNNNNNNQQHSGGPGGGPTGGDAGSLGGEMGGITRKPPPYYGGNTEVRGPIDNNEMSSGSGDSRLCRGHHLPILLLPFARLILVRSWHCRHTFLMGLSQACLPGLLLSLL q8mre6_drome BcDNA:GH22307 CT35098 Dmel\CG33202 Dpr-11 Dpr11 Dmel_CG33202 dpr11 CG15181 CG15182 CG15183 CG31309 CG33202 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRSWKNRSRSEMQTLETRVRPLQGAQLTQLLLGGILCLTIASHTQTSAEAAGGRVSGPGAGTSEGAGTSSASAASTAISSDESGDPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVTSSAATTRAYALSILALLLSVILIGVGHRT a1z6h9_drome dpr12 CG7796 CT34165 Dmel\CG34385 Dpr-12 Dpr12 CG14469 CG34385 Dmel_CG34385 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPMVPPRLLLRLRRPLHLMELRILLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGGINGDSKLDNNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTVVVRHIFLT a1zb15_drome dpr13 dpr13-RB Dmel_CG33996 CG12557 CG14493 CT34204 Dm_2R:58906 Dmel\CG33996 Dpr-13 Dpr13 CG33996 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPASSGLYRIKNGRVLDRLQKPAALIFIIAYIAACGICDHTASASPGGGKTVAATMTTPASEPSVRHINQNLIMSQSKEGEPVPVPQPYAQSAASAGGSSITSFDSTNVIDGQSQPTPTHLQEAVLQTHSHSRIQAKDTAGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFKGDNPAAMYHGHVGGSTKTTQSQLHMIMIIIASGYRIFHTSVYMKIV q9w3n2_drome CT30653 Dmel\CG10946 Dpr-14 Dpr14 Dmel_CG10946 dpr14 CG10946 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRSRLFWILAIIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVCISGSISVAGMNRGLGLGQVWGWGWELRR q0kic0_drome CT34444 Dmel\CG12591 Dpr-16 Dpr16 mdcds_51595 Dmel_CG12591 dpr16 CG12591 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGPSFLTYFAALAATATPMENASLIASPATGTSTMGSAGSPVLMLGDDQQQQEYDTTVVDSWSDRPDTATLTKGFSIPSYLPPFPEFIPADLPHMLRNASSGAAPPADIGPSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTAARPHRLGHGYTSLHQWLIFLLVALNKT q8swt7_drome dpr17 CG14738 CG31361 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPQTSPNWRQADNERTKGAVSVIAARNWATGTATQDWSQKSSSSWSSTSRRTGISRTRTRPATLTTEMTVAGRAERAGVGAPWCRRFFHTSPLASWLRISFVLLVLPALGFGIQVVTCSNPELGASAPDPVDLTWGGKNTEGQLTTATRSTLPDSPMTTQNDLITTASNLATAKKPATAASEAVVDTAETAETAPPTEATSSWSSTAVARGMSSADGAGEAIATSQSAQIGLTTQATVRQTEAQTASTATQAAAATSAATSAAIASAAAATETAAEMLISTIYPASTETDLHNSIERVEGQRGKMANAFHPGVPDSLTKGFSIPTFLPPFPVFAAADLPAYRAAADAAEAAKLAAEAAAQAAAAKTSSEAVTMSPEEQRRQMFNEQHSYLAAHRDGGDGAGSAVRRNLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSVNIPHRPSCQRRQGRRKAGGARATRRWDSWESLDSYGRCRERCTHRRPRRDSPIERTPGRGVRLPIICKLLRHLQLRNLG q9vkx8_drome dpr19 BcDNA:LP09705 Dmel\CG13140 Dpr-19 Dpr19 Dmel_CG13140 CG13140 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEPKRWHLHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLITLGGLNGTSGVTLAGGILYFSGLFLLMGAVVFDRFSLAATHKVFVAFIIVTMHS q59dz4_drome dpr2 BP1042 CT33638 Dmel\CG33507 Dpr-2 Dpr2 CG14067 CG14068 Flk CG33507 Dmel_CG33507 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAMEGKCFGCIATPILVIMISISRAWTMQQQHLSPAIQQHPAVKSLSHLVDGNDNLLPMVSAPSSIDNDYVYIASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMVASSVVRWLIGGQRIGSNSCHDSCSNLSTLHINYCNLRAKITSHLKEHRCLGPGSTVES q9w0l9_drome dpr20 CT9818 Dmel\CG12191 Dpr-20 Dpr20 Dmel_CG12191 CG12191 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRLNEPAARTRPRTKSTTDATKFSSSRGDLHLDCAVPNLIRLLLLIATIMGSGLVQAKTIYDSVNMIQSLDALVEPRETTKVPLQTTPATPPTAHAHIHNQVSTLRSSYEDSDDGVDGDYVIPESQTSTVAILDQDSSMKGQDMESLSLQAGSGTVSPKSSPDSSGHKKNASFQQIGSQNVNALVPATVATTSSGLPSSSNASLATPTEPARNRSTGLVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHGGAVGWHSTWWNMVMLHAMALLVLNSLRGEFS q59e13_drome dpr3 CG15379 CG15380 CG15381 CRACM2 CT35425 Dmel\CG33516 Dpr-3 Dpr3 Dmel_CG33516 CG33516 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPAAIVIVKQHKEQQHQQHQQQHRQDQQDQKDPRAAKQICNINLCGFLRRSGADDVDVIEPRSPGHAADVDVAAAAAGATTSVAATAAAAAAATTRAAATTRAVIIIMALVVSIMQQQQQSLLWPFCNGLAAAAASTGQPDDSGDGPTLSTFLSSSQSQSPSPPAASASASSPSSFSSFAVAHGPQTEATNHTFKSLAFLDASFGSDLFAQTDAKRERSGAADEESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVINDENPAAMQKSGACPCALGPLQLLLHLLLLPELLLLRAGLAAGN a8dz27_drome dpr7 Dmel\CG33481 Dpr-7 Dpr7 Dmel_CG33481 CG33481 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSRGKHATFLNNSPIKIKPFIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRAFTAMITIISTKVLLYISSLMEHMYLRER q961t8_drome CT16895 Dmel\CG5308 Dpr-5 Dpr5 Dmel_CG5308 dpr5 CG5308 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRWRHAVRATFTSTTATESSPLIGKVISNSRAPQIAHEMLVEYFMALLVIMGLTAPVDKQSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLLGPTSSLQIRTPLSTR q9vt76_drome dpr6 BcDNA:LD13525 Dmel\CG14162 Dpr-6 Dpr6 Dmel_CG14162 CG14162 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPIAHPLPLCVAWLLLLVVIVMSDMTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLPTAPTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNGKYPLPCPTL q9vy33_drome dpr8 CG11477 CG14415 CG5291 CT16867 Dmel\CG32600 Dpr-8 Dpr8 dpr 8 Dmel_CG32600 CG32600 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTHWIIFLGILCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPATPPGCRTVQQASTFAEEKAMGQRSNRNCQDLQELEESQDLRRRGVERSAVPGT q9vfd9_drome CG12601 CG14862 CG14863 CG31114 dpr9 CG33485-RA CG33485 BcDNA:GH01517 CT34680 Dmel\CG33485 Dpr-9 Dpr9 Dmel_CG33485 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MATFQMEMRQQQHQRTNLRQRAAAVATSKARRQRQHHLQPESTDSPPYSTDCIRLWPGCGPTTADRVNGNPPTCNNTSSSDIGGNISGNTSNRISCCSCNFGRQRALIMLSMLVVVMALMSGNGVYAAQRDSYNSKDMSSSNNALPNEGVGGSAAGAGEAAAPGPTGIDGSGSGNNSSGNNKNGHPAAGSGAASESAALTTDASRSSVGGATTITGIPSSSLHKASSASSNTFSSQLASGFHRNSIDLEEARNAGPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEIIGAPDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPLAHSLSVCVPVCVLLQLGACRWIAALLGAALATPPPLRSTRRATGERPGSPGCAPIACDMRHFLASVLRWQWRWCWRWHWKGTQQQDPRHYLKPQSRRVAAACRQPYEADIR q9vct4_drome klg CT20712 Dmel\CG6669 Klg h214 l(3)rN712 Dmel_CG6669 CG6669 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNIISRSIRTGALAPPITAHASANANASGLRKSSQRRNRAPLQMNCPILIVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDGYNLEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLYRRVQMNETYQQPGRWHDFILTPEHRPASEPLTHIMSYTIKNLHPGGYYEAIVQAKNRYGWNEVSDIFQFVVATNSQDIGPEDAEVVASSKSRSNSASIGSLPGSTVLHTALLLALALSNCQFDRRRLGLG o97174_drome kirre EG:163A10.1 CG3653 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKRMRSSRLLVLPLILVLILTLLLQPIAVHAKSKKNKSSQSSHHGDSSSSSSSSSSSSGSSSAAASSANDESKPKGGDNGGQHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQGDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISCKYSMAISDDIFRQRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETAGRYFCKAVVNGFPEIGAEATLYVKRAPIITSHKVQFGGVGGRVKIDCLAFSIPKAEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVLNSYGGDSLVITLLREPGNIPVLLVVMGSMFCVAIILMIVMIIIVYRKRRSRKKPMPADVIPEASRGGDKLNELKSELRSKAYDVEYSEAGGDGLAINLTQSPMPDVQMKGATLGVPLAGPVKFDERFSGDFGGDRYNRQCHIKNLKNQQETAYKGSPQANGYAHYFEYALDYSPPGGEGAAVVVGSGGVGKLKNGGMNSATLPHSAAATVNGGGAGNGGGASLPRNQRHEIQQSQQSNGFLGNETDVISTTFAGQPLLQNGIDSRFSAIYGNPYLRTNSSLLPPLPPPSTANPAATPAPPPYHAARHGHAHHANGGLKHFVGGAVITTSPVGNVNINGGGGGGSTPSGGGGVGVGVAAGGSVSGSSSNLTASSNTLAATPLAGGGVGNSGQCAQSPSGQFILSNNGKGHTQKGPLATHV q9v787_drome hbs CG7449 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQFWITLTFAVHLATTICHVMAAVTAPTPAAQVAAPPVQKFHLTPHDLQILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVIEGYARNARVEVEERQNLTLHCIAENANPAAEIVWFQGEVPVSTAPIVTVNQTAPKRFTTSSTLHLQPRAEDDYKEFSCEARHKALPPDVPMRAQVQLSVLYPPGAPFFEGYSQGETLHRGQEVQIACRSRGGNPPAQLTWYRNGVAISSPQRTSGRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGANQAKVGDSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDGGWVSSSNISLTIDSQSRTFIAVCHALNTELTQNVVGSHTVNVLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAPSKLVDSKITSELSLLVNASDNNAIYKCKVQNAAIDIPLFATKTLGVHFPPETVKISVVPKNLVPGIRAKLICDSSSSNPPAKISWWKDGIPVEGLNLANRPGLWGGSVSTLEMYVNITQDLDGIVYTCQSHNEVLQRSVHETISLDILYPPKFETPQSTTFVGVEGAPFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAVLACHIRARPLEAAHVRWSRDGYDLATRTISSFENGTALLQIASVERSDIGNFTCIVDNQRGAPAAQNVLLVVQTAPEIDHSPGFTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALLIENTSPDDYGQYECVVRNSLGQASTTLEFSKPSRPDAPLQLRVGNVSDTGVDLNWTPGFDGGMQTYFRLRLKQHGEDKYKYVDAKPGHQNISLDGLKPGATYYFSVMAANEAGGSKFMPDIKLTLSKGSQPHSAEYTEKDELPNVMIIGITSAAMVLLVLNAALVAWFVIRRQNKSQSEAEPSNDDVYSKDDSQSVYKLPITALQADVQKKAAASTYLVENVDIIQSTAYPPKYQESSMCTPPYPLCNPDFTRTLPNPKRHSQRNSATGMIEGMQMRSKDDHMLISNGLYIPSPSPASSLVIKGSYISSPSPAPPADGSYFNMSDKYMSYPPVTY iccr_drome Irregular chiasm C-roughest protein rst CG4125 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLHTMQLLLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTKLPPADVISEHQITKNGGVSCKLEPGDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLTTCSTKSNGSSTIMQNNHQNQLQLQQQQQQSHHQHHTQTTTLPMTFLTNSSGGSLTGSIIGSREIRQDNGLPSLQSTTASVVSSSPNGSCSNQSTTAATTTTTHVVVPSSMALSVDPRYSAIYGNPYLRSSNSSLLPPPTAV q0e9i4_drome Dscam1 Dscam CT39257 DSCAM 43Bc DScam DmDscam Dm_2R:13579 Dm_2R:13612 Dmel\CG17800 DsCam Dscam-hv Dsm Neu1 dScam dscam dscam1 l(2)05518 l(2)43Bc p270 CG17800 Dmel_CG17800 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVSQHYEEDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHSDEKENFYPGTEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPIGSKAPSVPTGVMVFQQQVPLLSTFAMLCQAQAFPVPVFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQEGYSARGSLEVQVMVLPRIIPFAFEEGPAQVGQYLTLHCSVPGGDLPLNIDWTLDGQAISEDLGITTSRVGRRGSVLTIEAVEASHAGNFTCHARNLAGHQQFTTPLNVYVPPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPLDDGSGHGNVHTRIRLPAWMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLYEELKAPPVPMHGNHYGHAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDHGPRGNYGAVKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV q94538_drome fra frazzled CG8581 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAITTNRSSRTLWNWLLSSCLIFQLIGSSLASQALSFTLEPQDAVVPEGHSVLLQCAGTASIGRGGKSKSNLPSSVSIRWRGPDGQDLVIVGDTFRTQLKNGSLYISSVEENRGLTGAYQCLLTAEGVGSILSRPALVAIVRQPDLNQDFLETYLLPGQTAYFRCMLGEANWQEGVKHSVQWLKDDLPLPLDKLRMVVLPNGALEIDEVGPSDRGSYQCNVTSGSSSRLSSKTNLNIKKPSDPGVENSVAPSFLVGPSPKTVREGDTVTLDCVANGVPKPQIKWLRNGMDLDFNDLDSRFSIVGTGSLQISSAEDIDSGNYQCRASNTVDSLDAQATVQVQEPPKFIKAPKDTTAHEKDEPELKCDIWGKPKPVIRWLKNGDLITPNDYMQLVDGHNLKILGLLNSDAGMFQCVGTNAAGSVHAAARLRVVPQGVKIKKRKSQGHSTKSLQTFDNLTKRRKPFNSGEQLRTKSGGSFPFPDEDDDLDDNDSGTTRLRIPSGKLPKFEQPLNDRRFNILNAGSALPLDNQSKSYEDDDDDYDEDDPAKEALLEAYKQGEDAHKILDSWQQSKSKKSQQQKQSPASPDSPEQDPSVPHPGGKPLDSGLQARLPSQPRDLVAQIVKSRFVTLSWVEPLQNAGDVVYYTVYYKMNNSEREQKMVTKSHDDQQVNIQSLLPGRTYQFRVEANTNFGSGASSAPLEVSTQPEVNIAGPPRNFEGYARSHKEIYVKWEEPTVTNGEILKYRVYYSENDSGADLYHDSTALEAVLTELRPHTDYVISVVPFNRNGMGDSSAEIRVKTFSSTPSEPPNNVTLEVTSSSSITVHWEPPAEEDRNGQITGYKIRYRKFKDAPQVKSTPANIRYFELSNLDRNAEYQVKIAAMTVNGSGPFTEWNRANTLENDLDETQVPGKPIWISIHPGANNIALHWGPPQHPEIKIRNYVLGWGRGIPDENTIELKETERYHILKNLESNMDYVVSLRARNVKGDGPPIYDNIKTRDEEPVDAPTPLEVPVGLRAITMSSSSIVVYWIDTMLNKNQHVTDNRHYTVSYGITGSNRYRYHNTTDLNCMINDLRPNTQYEFAVKVVKGRRESSWSMSVLNSTYQNVPVTPPREVTVRLDEMNPPTVIVQWIPPKHTLGQITGYNIYYTTDTTKRDRDWSVEAFAGEETMLMLPNLKPYTTYYFKVQARTTKGANNAPFSALVSYTTSAAVTMQEPDTIAKGIDNEKLLYIIIAATAVVLLVVLLGVLLLCRRKPQSSPEHTKKSYQKNNVGVPKPPDLWIHHDQMELKNIDKGLHTVTPVCSDGASSSGALTLPRSVVHSEYEVETPVPGHVTNSLDKRSYVPGYMTTSMNGTMERPQYPRTQYSHQNRSHMTMEAGLSQQSLTQPQSNSMAQTPEHPYGGYDANFCNAGNAAAGNGCVSTIESSKRGHPLKSFSVPGPPPTGGATPVTKHTPAVTIRPQNQSPYKKPSFSAATPNRLQGGGSVVHSTDEIQRLAPSTSTEELNQEMANLEGLMKDLSAITANEFEC netb_drome Netrin-B NetB CG10521 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVRATGTRMGLLLPIILALAIGSSAAGISSNDPCYFEGKPRKCLPSFVNAAYGNPVQASSVCGAQQPERYCELLRDGNAGECRSCEQQRYGPAALTDLNNPSNVTCWRSGAVNVPHDPDSAPPDNVTLTLSLGKKYELTYISLSFCPRSPRPDSLAIFKSSDFGQTWQPFQFYSSQCQKFYGRPDRAKISKFNEQEARCINSQHDTGGAAQRFAFNTLEGRPSANDLDSSLVLQDWVTATDIRVVFHRLELPPQLLKVKNANAFSDEMGGSREEDEDDDADLELDGEQDEYDYNLQDNDSADAGYDEYEEPKKHLELDDDHLHLDYASDGESVVKRQGKHKGSAYEKHYQSKLAATTPPQQPPKVTPPGKVTPPSTAAPSAAASAVTLPISQHYAVSDFAVGGRCKCNGHASECVATVSSGSGTALSDQDDGQDEDTPSAPSLANHFGRSTQMSAKLTMTCACKHNTAGPECERCKPFYFDRPWGRATDNDANECKMCQCNGHARRCRFNLELYKLSGRVSGGVCYNCQHDTTGRYCHYCREGYYRDATKPPNHRKVCKRCDCHPVGSTGKTCNHLSGQCPCKEGVTGLTCNRCARGYQQTRSHVAPCIKVPTNANMIQAESAGGGGGGGTGDYKDGGGSQVEEMKKYCGKCKASPKKLNLNKFCMEDYAILAKVIGHDRASQDISTEKFSIERQNEIYKYEINIQTIFKRNPMSGTTSSLLGRGNMMLLVPRKSIECQCPKIKLNKSYLILGRDSEAAPGYLAIGPSSVVLEWKDEWSLRMKRFQRRARKCS ihog_drome Interference hedgehog ihog CG9211 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTLLTSSLLLFSLLTSRLEAIPVLEKSPAHPAHSAHPAHPAHPAHPAHPSPGVRILRAPESLVAPLGDEVVLECETSLQPERFEWSHRSSRSPGAGFKYLKTGTAKANVSQEAAISRLRVLVRPDTLGEYRCVGWFGPLVVTSTIARLELASTSLVDAQESESPLQWRVSAGNSVLWSCGQQVQSNPSASWSYYRNGVEIKPEFIGTNGNLFLSNVSSESSGSYSCQATNPASGERIQLPGSLQLQVTPEQRSESKSPHLLRGQPSSQEITIREGSSLLLLCPGVGSPPPTVVWSSPDVVGAVKNKRSKVFGHALEISNTRVNDAGTYICFQDNGVRPALEHYIKVHVEQPPQIVRPPWADLTNEGDRLKLECKATGVPTPEIYWLLNGHSSIDDSEAELSNNFLILHSVLKRHAGYVQCFARNRLGEHSAGTLLQVNPKQIQEPRESGGTHRPKPNQGSRQKQMYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRPKTSTTEEPTLQMGDRDTTTPSHNETFNMSPMLTGTIGGGAVLILLLISTCFCVCRRRNSRSRGNNPNKPRMAELRDDFVPLGNCSPTKQRQRTRHIHITLNPLAQQQQQALEEKNDTDQDAPYYQRPSSYDYDPTLRRMSSSSLRRSQRTLERAGGSNGSNNGNNNNLNQSAEAGSIENPGKPGRVLMKRPRLSSRSENLSSGSLNSVGV vein_drome Protein vein Epidermal growth factor-like protein Protein defective dorsal discs vn ddd CG10491 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYAQHLRKWSLKTKKQLMPLILLIISYMLLLNTCVLSSSATTQQQQQQQQQQQHLPRLWEGSAEESSYYIPLSSDNGSGSSESSAESGSSSSRSSSNNIDNNILSRLLSLNSNSLSSRSNVKLKPATVFDAGSSTPAQQEQHVAAVPEQQQQQQQQQQSMQKVPNTLINSQIYNLLYNGMPSEAASSKMRRHIQPSQLPHQPESRAQLPSNYSSRPAVRSYLIESYEMPESMLEDRSPEQAARSRRDGSNTNGSRQQQRTGHRQQLQQDKRDHRRQRQDQQKEQRQQQQQRQHKSGNKHQQQQQQRRKHQRKHQRYNRYCSARDPAQLAFAAPTVFQGVFKSMSADRRVNFSATMKVEKVYKQQHDLQLPTLVRLQFALSNSSGECDIYRERLMPRGMLRSGNDLQQASDISYMMFVQQTNPGNFTILGQPMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAIIKHGKKLRIVCEVSGQPPPKVTWFKDEKSINRKRNIYQFKHHKRRSELIVRSFNSSSDAGRYECRAKNKASKAIAKRRIMIKASPVHFPTDRSASGIPCNFDYCFHNGTCRMIPDINEVYCRCPTEYFGNRCENKWPDSRYFVAIYGQIHTLNNDY q7ksx2_drome AMA BG:DS00276.6 CT7244 Dmel\CG2198 M109 ama Dmel_CG2198 Ama CG2198 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQYNKRPDMARLRLLIGLIFCLAISLDSVLSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHLFQTVIPVPSLS q9vnp2_drome nrm CG32458 CG41452 CG8779 CT16082 Dmel\CG43079 Dmel_CG43079 CG43079 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGNMALRQSAKDVAKSNCVAVRSSISLSLVLVLCLALVDSSTAQVDTTISQQESQSVVLPCPVDAEKCGKLHSLNWFKGDDRIAAMLLGDSNVTSVNKEFDERVTVEQNPYRLVIKDLKIADEDIYLCDTTFFIPEETCDNFNGYRIELRVLVPPTEVVILDAKGDRIKNGSVVGPMQERQSLKATCTVRNTRPQPEVSWFRGTKRLTTYSPTHDLVDGLYTSTLELDWTLSREDLAQDIECRVKSAAIQNVTVTKFSVDLQVRPTSIDINGVKHHTVQGSKVVLTCDIHGARPAVNLTWYNTTTIISSGENEITEVRSKSLEKSDGTFHTQSELIFNATRFENDRVFRCEAENIVLQINREKPISSALTLEVLYPPVVKVSPSAITANTSEIVLLNCEYFANPASLTQVEWYRNDILVNVNDTTHYKGGNSENVALVIKSTEKEDIGNYSCQLSNNIGKGTSDQKINLDVQYAPTVEILMIPEGPVKESDESNVTLFCNVLDANPSVLTKVRWYANSTLLKELPDCEETREDLCHIDPSKLLLESIGRGFFYNYSCEGFNAAGWGPRSEDKELLVHYEPGPAALSHFPLVAVKKKSVTFSCSVDDPGFPESNRFRWLRGGRGPLQDIVTKDWTVEPVGLDSRTNYSCYAYNEGGKGVMATVNLEVHAPPFFIKNLPPYTGILHSSPNATLTCRIECVPRCDISWQKDGVPIERNDSRYFIKEKYMDASPATGDFESMLSVLHFNMPNWPDSKFNIEADNANYSCVSTGNIVGGSIRSRTYFGIEYAPENTTVSENIVYVQEDTIPGRVICKSRANPEPSYKWIFKNETIANGNALIINTAMNRNDDGTYTCLAYNKHGSSIAKTVIKVQFKPRCEIERQEIDDQDTLICTAYGNPIEADFSWSIKTENETDENLGSGKKENSVEKSFYILQTDYAISRTYRCVANNTVGYGPFCEIEVAEQLAWWQLWEKNTLIILVAAILGLLLTVIVICCIIICICRRRRRQDKLHDKSSSLREPLTEPGEYENLPFHGLQTAPNKPINAQIFDDEFIYADLESQHYGPINYKAASLYSQVKKNKESGALDDLK q9w1h6_drome Dmel\CG5597 5597 CT17698 CG5597 Dmel_CG5597 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDTLLIAILAIGLLHRDALCYPTRDESEDKIIVLQNEEMEPTILDCDYEVEESPKFITVKWYRDDKSIYQWIFGTPPYAIPEFRNEIDSTYESSTEPSKQYSSLALINPTIATTGDYKCVVQTSLNTFSSHQRVQVIDLRNYTLELSHKTIHNETQLNCTVTNVYPRPTITIISNDMDVVKREPMVYENEEGYFDGSAVVAAYDTDDDPDAYQCVVSFEGYGKNLTTVATSAAAGRSHVDFSLWLFCFLYYLLCKLKVLA a8juv7_drome CT33235 Dmel\CG32796 EG:BACH59J11.2 Dmel_CG32796 Boi CT23737 boi CG7894 CG13756 CG32796 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAEIRLVVVLLVLMTTCIYTLQASDSNSSVATTLGVLFERAPESAVAPKGDEVVFECELNLKPDRLEWRFRRGDSSEPYLYLRPSAGYNVTSGSDGLAWRLRIYVSAQTAGDYQCVAWYGPGALASTPARLALVSIALDVGQGSMGARSSIRWSVAPKNCLLIRCGSVISNPPAIWSFYRNGKKLPQSELLPGAAGALVLDTVTAKDAGNYSCVATNSITGDELRLPQTIELRVDYTDRTPPYFLQRPPIEYSARPGETVVLECPGVGSPRPRVIWSSPNVVEIYNNRSTILSYGLQITDVKPEDQGSYICMLDNGIAPPIDHTIKLSVLQRPTILRGPAATLTNESNPLLLDCSASGNPQPDIYWLINGEDATKDPEAVVDNRSLQLKRVQKRHAGVVQCFAKNILGETSEGNILRVNPLEITGEDDEPLGEVPVWPVHESNTGMGTSSTSGGSKNKSGRRKFKASMVPPSRPNVTRLSDESVMLRWSVPQNSGLQITFFKVQYRMLGDGKNRRKNWQTTSDNIPYGNAHGSGPGQGNSHWRARNRDREYEMGNPPKNFTSSVTGLTAGKYYRFRIVAVYSNNDNKEGNTSLKFFLQNGTSKSNLPVPELREVETLSESAVVLHWSLVSSTQNEDIDGYYAYYRPADSAAEYLKATVDGGMSRSFKIDLLRPGTPYEFKLQSFNSDAASEFSAIRQARTRKTHEQPASSSATPVPANKAVEQHQNSLYPLIAGAAGGGILLLIASLVVCLCLKRRENSQPEDENKPQLEHIQADFVTSAVLGVGGHHKSGDVRRLNGVIPRMNITPNPLAQETASDKNRNVMELRFLPPLANGNGNGNCMARDLALERSNAEEQQDEDGHEDEKGLPAVASSSCETLEACDAAIKLNLPQKHDQEQLDAPNAVLEAPSKPLPPLPKKPANGAGQNNSGLHQNGLHHAQPYHPPGTPTLMHKRLDYHQQPPPVPPHSAYYQQAPTHQPSPMMERSVRGHQQPGGFHMEEGTPTPTRIPSLRRQRRTSGNQQVHNSHSNLNIGLSHHNNNNNNLPPHHQHLHHHPGHPGGLVGIPIVPGSPRVQRSPMPSRAMIKRTRLGSHTDNISSGSLNSIEV q9vqw1_drome fred CG12675 CG3390 CG3393 CT11413 Dmel\CG31774 CG31774 Fred Dmel_CG31774 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTIKLLIIGQLWLSIGLISGDDSLDTREGVDLVLKCRFTEHYDSTDFTFYWARWTCCPTLFENVAIGDVQLNSNYRLDFRPSRGIYDLQIKNTSYNRDNGRFECRIKAKGTGADVHQEFYNLTVLTAPHPPMVTPGNLAVATEEKPLELTCSSIGGSPDPMITWYREGSTVPLQSYALKGGSKNHYTNATLQIVPRRADDGAKYKCVVWNRAMPEGHMLETSVTLNVNYYPRVEVGPQNPLKVERDHVAKLDCRVDAKPMVSNVRWSRNGQYVSATPTHTIYRVNRHHAGKYTCSADNGLGKTGEKDIVLDVLYPPIVFIESKTHEAEEGETVLIRCNVTANPSPINVEWLKEGAPDFRYTGELLTLGSVRAEHAGNYICRSVNIMQPFSSKRVEGVGNSTVALLVRHRPGQAYITPNKPVVHVGNGVTLTCSANPPGWPVPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAHLGSEGKYHCHAVNELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDVDYAVTCSAKGKPTPQIRWIKDGTEILPTRKMFDIRTTPTDAGGGVVAVQSILRFRGKARPNGNQLLPNDRGLYTCLYENDVNSANSSMHLRIEHEPIVIHQYNKVAYDLRESAEVVCRVQAYPKPEFQWQYGNNPSPLTMSSDGHYEISTRMENNDVYTSILRIAHLQHSDYGEYICRAVNPLDSIRAPIRLQPKGSPEKPTNLKILEVGHNYAVLNWTPGFNGGFMSTKYLVSYRRVATPREQTLSDCSGNGYIPSYQISSSSSNSNHEWIEFNCFKENPCKLAPLDQHQSYMFKVYALNSKGTSGYSNEILATTKVSKIPPPLHVSYDPNSHVLGINVAATCLSLIAVVESLVTRDATVPMWEIVETLTLLPSGSETTFKEAIINHVSRPAHYTTATTSGRSLGVGGGSHLGEDRTMALAETAGPGPVVRVKLCLRSNHEHCGAYANAEIGKSYMPHKSSMTTSALVAIIIASLSFVVFLGLLYAFCHCRRKHAAKKESSSVGGGVGGGNANATANPGSTGAKEYDLDLDASRRPSLSQDPQQSQQQPPPPPPYYPTGTLDSKDIGNGNGGMELTLTALHDPDEQLNMQQQQHHSNHGQYQQPKAILGIYGGVAGSGGNNSGGQHPHSNGYGYHVTSAIGVDSDSYQVLPSVANSAAGSHGHGSGHGHGLGAGE q9vqw7_drome CT13476 CT35484 Dmel\CG12676 E(Elp)24D E(Elp)[24D] Ed 1X5 l(2)k01102 Dmel_CG12676 ed CG15424 CG16842 CG12676 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRRKTTTKGTAIVNSRSARRAATTICNFFLIALVALSSTTLADESIDTRENADLTLKCRFNDKYEANDFSFFWTRWTANPAQFDNVAIGEVQLSSGYRLDFQPERGIYDLQIKNVSYNRDNGRFECRIKAKGTGADVHQEFHNLTVLTPPHPPVISPGNIAVATEDKPMELTCSSIGGSPDPTITWYREGSNTPLPATVLKGGTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYPRVEVGPENPLRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHTIHRVSVQDAGKYTCIADNGLGKTGEQELILDILYPPMVVIESKTREAEEGDTVTIRCNVTANPAPVTIEWLKENSPDFRYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERVGNSTVALLVRHRPGQAYITPNKPVVHVGNGVTLTCSANPPGWPVPQYRWFRDMDGEFSSTQKILAQGPQYSIPKAHLGNEGKYHCHAVNELGIGMMATIVLEIHQPPQFLAKLQQHMTRRVADTDYTVTCSAKGKPAPSVKWLKDAVEILPEENLYEVQTNPDQGLNGMVTVQSQLKFRGKARPNGNALVPGDRGLYTCLYQNEVNSANSSMQLRIEHEPIVLHQYNKVAFDIRETAEVVCKVQAYPKPEFQWQFGNNPSPLTMSSDGHYEISTTTDNNDIYTSVLKINSLTHSDYGEYTCRVANTLDTIRAPIRLQQKGPPEKPTNLRATEVGHNYVSLSWDPGFDGGLSKTKFFVSYRRVAMPREEQLIPDCATLANSNSAWVEVDCQRDIPCKVTALEQHQSYAFKVKALNPKSDSPYSSEIMVTTKVSRIPPPLQVTYEPNTRTLGIDVGATCLNLVAVVESMVNADSPMAAWEVVTTMDNLQLSGNGPTHKEKIIDRIIGARRVGGGRALGHTISEDEDDNGLNSLALEDENSPTVRVKLCLRTNPEHCGDYTDAEIGRPYIAEANALATPTLIAIIVSCVVFALFAGLILMFCRCKRNQSKKSAAAKDYEMDSVRPSIVAAQQNQAPPPYYPASGLDNKALEHSMDLALSMEDQKTALYATQNGYSYHPGSGVVGVGMGGGVVGVGVGGSVVSGMGGGVGGIGGSGVGVNGIPGLSAHTMPGNEWVNMGYMENNYSNSNNGGSVNSQDSLWQVKMSAAAVGNQQGMVQAPMNQYVEQQPAYGYDPLTHGGYGAVDDYAPYPHLTATPSQVGDEYHNLRNSQNPSRQDYCSDPYASVQKPKKRVDQHLDSPYHDVSGLPNPYNMEHLEQDEVLPPQQHMSLSYDDSFEGEYSTTPNARNRRVIREIIV q7kse9_drome CT33960 Dmel\CG31190 Dscam-like Dmel_CG31190 Dscam3 CG12536 CG8106 CG31190 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSLLEPPCLVLEKALLLGALLLAVLATPLLATSGLRVPTFLLEPAPRLLFGNDTGAQVTCTAHGSPPPLVTWVLRDGSLATQVPGLRKISGNGTLHFPPFLAQYYRTDVHEATYRCRASNEAGTVLSRNVQVHAVVRRQFHVHVENTEVYLGNSALIKCAIPEYVRPYVRVASWHRGEEILLPDLSDVAGRYVVLAASGDLYVRSVRSEDGLMKFSCLVTNTLNGERQRSDAVMLQVKELSKNLAPRTTQKPVMEIHVERGNDVHLPCNIQGNPFPIFTWYRVSDSAALYPIPSSQRVILSRTLLLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHILPQVQIVNSGGTANFNCTTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCLVENQRASAQAMAELKLGDTVPELIYTFIEQNVRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVSLHHRFAIGQFVDMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQHSARLNVYGPPYVRAIGPIKAVAGEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQLVIKNVEPGRDQGIYTCIVRSRAGEEARRDMQLNVNSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVAPRWRYEPMDTAIMLGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSMRNHSLLLNLATDNDEGYYMCQATNEIGAGLKKTIRINVNEPARFEQSARNISSRRNDPVTLDCHAKGDEPITIGWTQNNGRIDLNNFRFSIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAENPYGRAEQIIFLAVQERPDTPSHLEIFEVGSRTVKLSWRRPFDGNSPVLSYLVQYQALKYLQSHGSLAAAGGDWNGHVINVSLPSTSISRSYDSDLRESAIVAGLTPATTFLIRMQAINEIERSAYTEAIVLKTQEEAPTEAPSNVQVQTGGESELIVTWQIPPRESWNGELIGYTVNCSEEKQNINFISVVNSSLKSTIVSGWATTKATLRGLRKYSRYAVTIRAMNSFGSGPWSAAIFGTTAEGVPEAAPQNVNCTALSSQSLKISWLEPPLQFHGGIIQGYKILYRPIVHQIDFPAKLEIKRTSNLETYLHTLHKASNYSIRVLAYTATGDGLASHPLFCQTDDDVPDAPAAIKAAALTADSILISWLTPKNRNGIISHYTVYSREAGRKGQAKTHMVRVDENGYPVTFESRSLAENQMYEFWVSASTSVGEGEPTSVIAQATNTRAPARIASFGQVVRKAVGTGLVLECLAVGNPTPRARWLTRDRPVTFSPFYEVTNEGNLKIHRVEGSLSGNYTCTANNLFGSDEIQYQVIAMKPPSAPQIIVQYASADSIRVSWDAPDDGGAPLQGYTISYHTAGESWSITELLPENNAFTISGLKCGNQYIIKMSAHNMVGSGVASEEINVWTKGKASQAPNANELIATNATCVNLKLSSWQNGGCSIHHFSIEHRPLGDIRWTVVTSDISNAEENRENLIFCDFLPAKWYQLRISATNDAGKTTEHYHFSTTNIDGITIPPPSVFPSENDLMNNLINSTNPTSGDWFATLIVVVIITVSIITIALTIKHRRTLCGPIAEGYESRTLPGDYKEDHENRRNQQVYSASPVKTVDKGNESEMYEISPYATFSVNGGRTGAPAKTPTRAVAAQTPLDYTMQFKTFGHPEGENLNATAYPLLPSSGFGHVKSKSSWHKQRYYNTEDESTLSKSMTIVAGSQAGHSKKSNGGRSAKSSAACSGVVAGSESDTSISPSTEFSNMPTYRVPCKSSRSSDGRAVVDMFRPDSSTESNNDQGSPAPERRHNTPRHVLGMGMAMGLGGGGGGGVGGGNGPAEKRSAGQRSRKHGSAAQQPSNQTLERRKCPGSSNSLDSEVDAETAASLAASIAAMAGSGAGADLSGGFRPPAGFHDGREPGDHSDCEREQRALDLEVQRVMESTGDAQLAKMDREELTSLLARYHEKKEQERLEYTIHV q0e8g9_drome Dscam4 CG13672 CG18630 CG33274 CG7060 CG42330 CT21829 Dmel\CG42330 Dmel_CG42330 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDLHSLFKAILILYVIRAETSQFVNGLDLQGPIFLHEPPHRVEFSNNSGGLIECSGHGSPPPEVEWTPIPPQQDMVFQLSNGSMMFYPFTAEKYRHEVHATVYRCKLRNLVGTVLSREVHVRGVVNQKYAVQVHDEYVMTGNTAVLKCQVPSYMSEFVLVTAWVQDTGMHLYPNTDIGGKYTVLSNGELYINNAGPNDAYKSYTCRTVNRLTGEVQISTYPGRIIVTEPKGMVQPRINVEKHSMRHVVLNGQTTLPCIAQGHPVPTYRWFKEENEQLLPLQLSERITIVSAGLLKITKARLEDSGKYLCWVNNTAGEETIQVSLTVTAPLTAHLQPQVQTVDVDKDAQFQCIVSGHPVHDVNWLHDGKPILRDNRVEILTDPPRLIIKKVQKEDPGMYQCFVSNEWEQIQSTAELQLGDASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQFTWSLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGISGSDLIVKCPVAGYPIDKIHWERDGQTLPINRRQRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIMPIQAMTNMLREGMRAAISCQILEGDLPVSFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQISDFFSPSDIWQNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTFYMSMLEGGREEGTHKRLLGPFVEMHETVRTQESATYQFWLTASTKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYNIVVKVPPEAPNLTVINAYTDSLLLEWMDNSHGGSPILGYVINYKRDNGDWEELQVDSKTTSHLLTNLWCGTRYQLYITAYNKIGTGLPCDIVNSYTKGNPPVQPKHSQMITNNSTSVTCWLDSWGDGGCGILYFMIESRVYGRSSWAVVSNHIPPTERIYTVSDLVPGTKYQLKVTAHNNAGSTTAIYNFTTLSTQGVIYNNDHSTPVSHLSDLPFYANFKLLLPICFSLLMLLALIGAALFLRKRKLASQARLASSSMSESPSLANLQNKQNRDQQYLAVRCNPGTSAPRGSNSNDSGSFGKAEGNEYIEDICPYATFQLNKQTYSESSYSGNVYSGPYHSVRGSFVYHDVKPESYHSKEPEYTKVRRKVGRLRDPHSESQEYDTLGSESDNDVSARALNSAKYRAQRDTQDETSSSSETTPTSMTRKSKPPFAARKGGKPGTSGKRHVRSSSGYSSHNEETTFSISNYPPNYQDHINPPARFSDANDKTKTQTSPRMRANQKLHREAFQINV ptp99_drome Tyrosine-protein phosphatase 99A Ptp99A Receptor-linked protein-tyrosine phosphatase 99A CG2005 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPRPQHHALLRAMLKLLLFASIAEHCATALPTNSSNSPSSPSPFTVASLPPTTASSSSSPAVISTSSFDRNLADLVNPEAETSGSGWESLETEFNLATTVDSSTQKTAKEPVLGTAATSIEQQDQPPDVPATTLAFANAFPVPVAGEMGNGNGNYNDATPPYAAVDDNYVPSKPQNLTILDVSANSITMSWHPPKNQNGAIAGYHVFHIHDNQTGVEIVKNSRNSVETLIHFELQNLRPYTDYRVIVKAFTTKNEGEPSDQIAQRTDVGGPSAPAIVNLTCHSQESITIRWRRPYEFYNTIDFYIIKTRLAGQDTHRDIRINASAKELETAMILQNLTTNSYYEVKVAAATFSVINPKKIVLGKFSESRIIQLQPNCEKLQPLLRQSHNDYNLAVLVGIIFSCFGIILIIMAFFLWSRKCFHAAYYYLDDPPHHPNAPQVDWEVPVKIGDEIRAAVPVNEFAKHVASLHADGDIGFSREYEAIQNECISDDLPCEHSQHPENKRKNRYLNITAYDHSRVHLHPTPGQKKNLDYINANFIDGYQKGHAFIGTQGPLPDTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYWPKDGVETYGVIQVKLIEEEVMSTYTVRTLQIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQIQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDALVEAIASGETNLMAEQVEELKNCTPYLEQQYKNIIQFQPKDIHIASAMKQVNSIKNRGAIFPIEGSRVHLTPKPGEDGSDYINASWLHGFRRLRDFIVTQHPMAHTIKDFWQMVWDHNAQTVVLLSSLDDINFAQFWPDEATPIESDHYRVKFLNKTNKSDYVSRDFVIQSIQDDYELTVKMLHCPSWPEMSNPNSIYDFIVDVHERCNDYRNGPIVIVDRYGGAQACTFCAISSLAIEMEYCSTANVYQYAKLYHNKRPGVWTSSEDIRVIYNILSFLPGNLNLLKRTALRTEFEDVTTATPDLYSKICSNGNVPQHVILQQQQLHMLQLQQQHLETQQQQQQQQQQQQQQQQTALNETVSTPSTDTNPSLLPILSLLPPTVAPLSSSSSTTPPTPSTPTPQPPQTIQLSSHSPSDLSHQISSTVANAASPVTPATASASAGATPTTPMTPTVPPTIPTIPSLASQNSLTLTNANFHTVTNNAADLMEHQQQQMLALMQQQTQLQQQYNTHPQQHHNNVGDLLMNNADNSPTASPTITNNNHITNNNVTSAAATDAQNLDIVG q0e9f2_drome sns 43-49 CG12495 CG13752 CG13753 CG13754 CG13755 CG18464 CG2385 CG8278 CT33230 CT33232 Dmel\CG33141 SNS Sns rost sns20 CG33141 Dmel_CG33141 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MALQQQHQRHQQHQQHQQQQQQQQQQQHIKWQQHATKRRRCRQHWIKHLQLLRLLAVIVLASAPVPSHAQQQKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAVIPGFPRYSVLGDRKQGIYNLRISNASINDDADYQCQVGPARLNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANAKPAAQIVWYRGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGPPYIEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQIRMAYRTSGRLSENIYTFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVGGRQVRNATSKTIVSPEGGWTTTSNITAVVEPNKRSLVVICHGLNMQLTENVVSTHTINVLYPPAPPLISGYMEGQIIPAGSVQKLLCVSSGGNPLATLTWYKNDKRINSVIRAADKSVSAEITILANVSDNQAQYRCEASNSATEIPLFQSTTLSVHFAPETVKIRIEPEELRPGMEATIICDSSSSNPPAKLSWWKDGIPIEGINNTSKPGLWGGTVSTLEFRVNVTQEMNGQVYTCQSANEALQRSAHEAVSLDVLYRPKFVPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNITVVVEYGTTIKSVSENIVVNPGEDAMLSCTVEGKPLTEEHVKWERVGYDMTVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPDPPLSLNILNVTHDTVTLAWTPGFDGGLKASYRVRYRMADREQYKYIDGLPNSHKLTIGGLRMNTLYLFSVMSWNELGQSSYLPDLARAETKEAPPPSHPASSLGGGPPTTSQTPLGGTSGMLLVGVGAGIVVVLLNVFVIGCCLHKRNEKRLKRGLELMPAELTEDSSNTPNLVIIGISLAAFGFLLVNASLVAWFFVHQRRKKVAETTNQPAKTATIEMYAPSSYNDTVTGETLSSVSEKSESYSNEGSSQPEYIDEVRKKAASTYLVEGSDMPPPRYQKDGTLPVIYPNNVVNACTLPHPRHNNGSAAIHMTRDDQMLISKGVYIPSPSPAPPPDGSYYNMNSDRYLSYPPMEYPAALDFTAQPMPMAHLQPMTVTSLATNGGPTLIGNGSVAAVAGGSGTLRRGILRGVVGVPQPDVTHHTSTVGGSPMQMLHDLHPVNLSASTLTTSTTLNGSLPTATATLPRQPHGILKDPNRNKQQQQQQQQQQQQQQLQHQQQLLNASLVGVGVPVSAPLGSLQILNLPPASGGLGNNLLMTTNAFDPTTVGLSSFGAVSQAGGIPVAYTDADGHLV unc5_drome Netrin receptor unc-5 unc-5 Unc5 netrin receptor CG8166 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAVINKAGNVIALLLVKLQLILLFTLSVSGELPQLDYGSLSASLEEDAIDPLTAMAPFANSLVTEESAQHKNNAELLGNSSEDENVRPQQGSSSSGLGSSGAAGGSGILLEEFNSGKLSPGEASNTLPIFLIEPESVFVVKNRPAVLKCKASHSLQVIFKCSGSSQPPPSTHETHVDPHTGVNMEEVTATIHRDLVDEFFGDGPFKCECHAWSSRGVVKSQAATVHIAYIRKSFNQSPTSLRLELGSRAELRCEPPGGFPEPKLTWHKNNAVITADSEPGITVSAGTLIFRQVALQHMANYSCSAENIAGRRVSDSAVLIVYVNGGWSTWSPWRECKCAGKPSQGRKRSRTCNNPMPLNGGAQCPGPQIQKSADCAACPEDTQIVSPDGFDISSSKRMARWSAWSDWSICSAECIQVRRRKCLTQGQTQISSEAEEAGDLLLGAPGVGMAALIAAAGVGAVGSPSEATGSSSDIIPGYGKSLCAGKDIQTAECRGEQCQIGKDDFDWTLYLGLAFITAVCFAFGTALICCARRGIRTNPHYNMARSVMDADYMPGVVEKKEMRMHIEASNMGYDYVNPGHRYLPGEHIMGMGIGCGGVTEHHYDVPNLSANYTNPIDHLSVDYLSETGESSTADTSNSTFDMNGKLSILNASKSSTYEMLGSAGGQLRLYGGELLLFVPEHAIGKHVKKHVSLLLLSDECSRVSCATESSILCSSVVHSAPRNYSFVKPVILKIPHCLVAPEQWHVHIYHADSEHDELSVNWRRAVSVGEETINTPMFVQLEATHVFIMTEQLGHFTVVAEPRIQQPSIKMKLLAFSQHTPPSNANCSLRIYVVKDFPNSRDICANVEAKLGGSFLGESQVFAFTLNSRNLNIRVRSADVEAAAPYEHAIPYQHILSNNSILHCEFSLRRQDQNSLCVDFGQGSEDDYYTFNIPAHSMSGSAEELASTTNTTISIDRQGNYVNESCVMDFVQLPHATKRLICGALDPPRADERDWRLLAKKLNTDRYIAYFATKASPTEQILNLWECRANSSPGSSSNSVSHTIMALLLTLKEMGRQDVLDIIVETIGPLWI tutl_drome Protein turtle tutl CG15427 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGVCADLGSHRWCRALSTQHNTEKSKEQQQQSQPLEIPEQRASKCRGDIDRTTTTTIPASKTLTASPAKTAAFTVKTTRRRRSRRRAEGSSICVPIRRGQGSTPTPTIQVLQFVLVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQADGTPTPEILWYKDANPVDPSPTVGIFNDGTELRISTIRHEDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGTQPHAPYNITGKATESSITLQWLPGYSGGSEYKQDYTIWFREAGVNDWQTISVTPSGSTQVTINGLASGTTYEFQVVGRNVLGDGMMSKVMTVRTLEDAPAAPRNVKAATQPPDSFFQLMPDEAGPKPGPPRNVSVTEVSNGFLITWQSPLERAHIVKFYTIKYRTDAQWKTLNRGQIRPEETQYLVKNLVGGRTYYFRVLANSEKSYESSDEVKFPVPARVKHKAITAGVVGGILFFIVAIILSVCAVKICNKRKRRKQEKEFNMVACRITDARNIAANNHHLHNRSTGSISSGQVPLKNNTEHYRDYESVFIVPGHPVIIKIVQTNPNIKSNRHSHCHLHWIWPPDRCTNCHSIYSSPNLEDGDEDDGGGGRRRSVSRIQRSLDGRFVLDVEGVSKLGYSQQTLESGNVDVVDGGLFERRNSNVSQKSSSDDGGFLSRRNFITARASWRRPLVASSSQLSLQSAADSARGFLQGLLKIGAKQSAVPPNSQSYFDEAVSGARYQNVLRPYTSSNNLYGNADRSRPLHINTISGSLSQQQQLYTPSRISRIFSSSPQQLQPHHQQLLLSSGGSGAYPTHFSDLSTVYPPNSAERSSHNLSSRYRYYSQELPSLRTIQEETRRQQQQKQHPLEDHFVPLQLPSPPSWRSYYQSQASYRPRTRWYPRHHSRLFSNRQQQHEMLSPLPQLNLNLRNSMNPGGLEASPESRSSSSGFGSKNTSNHPGSTSEWRLLPPYRAPPSPPKHSGYFGGQQAQGQTPHGSYSYPRATTPPYTMAHWLEMISRLNAATDSNLPKAPCPVDVGSVDGHYEFDPATPTPSASSMLREDLNLHIDTHPYHHHTLGPLSGSLLHSHAPYGGGARKQRSLPAHLPRYDNVEVRLQAMREEFYAYRKRQAMQQMESVC fas3_drome Fasciclin-3 Fas3 CG5803 Fasciclin III protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSRIVFICLAAILTDALTWAQVNVEPNTALLNEGDRTELLCRYGRSINYCRIEIPGEQKVLNLSPEWSKTPGFTYFGAGLTAGQCGVSIERVKASNNGQVKCSLGVEGEELSGTIDLVVALRPQQPIIELLSRPNREGYFNEGTEFRARCSVRDGRPPANISWYIDNMPANKRTTPLEVMSSTNDNVELSTSVQEIQWHLSPEDSNRKLVCRSHHQTDRESVPPQEAAYIINVRYAPVHQPDAAVYGLYLEHTAIVNITIRASPQPKIEWTIDGAIVGQGRTDGRYSAYEPQYLGNDEYNVTLAIAGLTLEDTTKIYNLRASNELGLTDYQVRISSSSKPPSSSLDVAAIVGIVVAVAVLVLVVLLIVFARATGRWCFGGKSIKTPTNETSDTESADIKATSTATATTTMGGVGVSAEEEETVNEQESPQEQQQQQQKKAKRLPAFAAAILRRFNEKDSRKYKDNQESLNIVEGSVQEIPATNNAIDGNDNEPKAIVWQSTSPVWTFK egfr_drome Epidermal growth factor receptor Egfr top DER c-erbB CG10079 Gurken receptor Protein torpedo Drosophila relative of ERBB protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLLRRRNGPCPFPLLLLLLAHCICIWPASAARDRYARQNNRQRHQDIDRDRDRDRFLYRSSSAQNRQRGGANFALGLGANGVTIPTSLEDKNKNEFVKGKICIGTKSRLSVPSNKEHHYRNLRDRYTNCTYVDGNLKLTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCHMRTIQWSEIVSNGTDAYYNYDFTAPERECPKCHESCTHGCWGEGPKNCQKFSKLTCSPQCAGGRCYGPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEAVSKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGECVPCNGPCPKTCPGVTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERREVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADCGYISNAYKFDNRTCKICHPECRTCNGAGADHCQECVHVRDGQHCVSECPKNKYNDRGVCRECHATCDGCTGPKDTIGIGACTTCNLAIINNDATVKRCLLKDDKCPDGYFWEYVHPQEQGSLKPLAGRAVCRKCHPLCELCTNYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQRECFQRHPECNGCTGPGADDCKSCRNFKLFDANETGPYVNSTMFNCTSKCPLEMRHVNYQYTAIGPYCAASPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEPLRPSNIGANLCKLRIVKDAELRKGGVLGMGAFGRVYKGVWVPEGENVKIPVAIKELLKSTGAESSEEFLREAYIMASEEHVNLLKLLAVCMSSQMMLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLSSDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKFTRLPAYTSQDEKDLIRKLAPTTDGSEAIAKPDDYLQPKAAPGPSHRTDCTDEMPKLNRYCKDPSNKNSSTGDDERDSSAREVGVGNLRLDLPVDEDDYLMPTCQPGPNNNNNMNNPNQNNMAAVGVAAGYMDLIGVPVSVDNPEYLLNAQTLGVGESPIPTQTIGIPVMGGPGTMEVKVPMPGSEPTSSDHEYYNDTQRELQPLHRNRNTETRV p91643_drome kek1 CG12283 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHIREAVFLVLTLLPGMILGTRYNQLHLYANGGASSSGPGGYRPAPSSQNEVYSIADSQPMTEDGYMPPSQHFPPTHSDLDPPAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDCRLRDTKLWLMKRNIPYPVAPVCSGGPERIIDRSFADLHVDEFACRPEMLPISHYVEAAMGENASITCRARAVPAANINWYWNGRLLANNSAFTAYQRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVSMRAAGMASLGSGQIVGLSAALVALIVFALGVIMCLLLRVKRQPYVDSKTPNHMEVITSVNHQNSITNKTQPATGNGSIGGVVIANGAVANIIDGGVVQGGTLERKSSGRGGVPHGVHDQRSANPVQKPPRLTDLPYSTQGYDNNGSVLSTASCFISPSGSTGNGGNNPDLINDTKRFGSDEFADLKIPPISGVGVGGSGEYSRANGCDSLYPSGLWEHGAPVGTTSADDLFMKRYTDKTPIIDSTQLYDLHERTAATDYFSKTFPRSHLQQGMMTGGGGGTSTASTVTTNLSGGSSSGYPNDYGLPLVPGAEHQHNHQLQMHPLQQLQQQLTSTLNHQKQEGSSTGSSPHFSSRTLPRLHEGSGGGGSSRSSPTPAISGGHANQAANPSTSSSSCSILPNGQPINAKTIRVWQKGGVPVLPPVTALKRALISSSRNSPDEGYQEGCGTDV lach_drome Lachesin Lac CG12369 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MWRPSISNCVWSTLLLAIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCPPACGQAYIAGAEDVSATSFALVGILAALLFAR q9vgh2_drome 6959 CT21563 Dmel\CG6959 CG6959 Dmel_CG6959 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MILVVAIAAIILAIGAGGVLGENSSSCGPNFPAACSCGQEMYESEMQYVVNCTNAGLVNTSVLEFMPEQVEVLIFTGNRITELPWNVFGSINNYKQLRIVDMSSNHIREIRGKSYHHVPRVERLILNHNNLSISRYEDEVNHHHPRVFSNFINLQSLHLTDAFEDNSSPQLSEDLHDIFVNSQLVKLQKLHLEQNEITHFKDRNVFCDLPSLRDLHLGDNDLRDLNFEVRCLNNLRFLDLERNKFSFVKPTDLRVLNELEERPNRTANLIVDFNLNPFGCDCRTAPFRAWITTTRVTVRNKDSLMCFHSTGHVDAEPAHLLQMDMGQCADAIAAAATILNTAEDEPHYGDPEASHLQPQAHISGHTATLIFLLIVLTMILLGLLVALVYVSRDKLKYMITPVFDNVAKKVQYTSIKDEDCPEVHV q9vhq8_drome anon-EST:Posey178 43462 BcDNA:AT05815 BcDNA:GH22170 CG11718 CG11729 CG11730 CG11731 CG11733 CG31264 CG31369 CG31462 CG42285 CG42286 CG43462 CT32186 Dmel\CG45263 GH22170 GS3056 MRE1 CG45263 Dmel_CG45263 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSQNRSKRSSRSRSSISTSISSSGSSTKIAQLLLLIGIAVASCLPGSEGFQRFSEQPKYTEVNPAEDTLLTCKVIDKRGTCSWQKDNKPVGIYTKKYEWASRMPTSDNGNVLHLDLHPPPVQLGGDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNITADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERHGDILRCAAYHESYTAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADANPPASIVWRRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQNSVGTSEQLSVQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWVQRMAHGSKYVERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHILHADEHDSRPYYLVVENERGTDRHAIHLIVEGTFAEPYEMSYLMGVAGGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDKDSEKADLKSRSDSTSGPQGDSIYTTPAGFHHHQQQQQQQQQQQHAAAAAAAALHAASQHPQQQYPGHGSPEAMKLKVRIYETERLQTPIRIQISKSSQDLAGSEDEDDS q9gpp6_drome robo3 CG5423 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDLRFVFIVFLLKWTHAQGSHPPRIVEHPIDTTVPRHEPATLNCKAEGSPTPTIQWYKDGVPLKILPGSHRITLPAGGLFFLKVVNSRRETDAGIYWCEAKNELGVARSRNATLQVAVLRDEFRLEPQNTRIAQGDTALLECAAPRGIPEPTVTWKKGGQKLDLEGSKRVRIVDGGNLAIQDARQTDEGQYQCIAKNPVGVRESSLATLKVHVKPYIIRGPHDQTVLEGASVTFPCRVGGDPMPDVLWLRTASGGNMPLDRVSVLEDRSLRLERVTIADEGEYSCEADNVVGAITAMGTLTVYAPPKFIQRPASKSVELGADTSFECRAIGNPKPTIFWTIKNNSTLIFPGAPPLDRFHSLNTEEGHSILTLTRFQRTDKDLVILCNAMNEVASITSRVQLSLDSQEDRPPPIIISGPVNQTLPIKSLATLQCKAIGLPSPTISWYRDGIPVQPSSKLNITTSGDLIISDLDRQQDQGLYTCVASSRAGKSTWSGFLRIELPTNPNIKFYRAPEQTKCPSAPGQPKILNATASALTIVWPTSDKAGASSFLGYSVEMYCTNQSRTWIPIASRLSEPIFTVESLTQGAAYMFIVRAENSLGFSPPSPISEPITAGKLVGVRDGSESTGTSQLLLSDVETLLQANDVVELLEANASDSTTARLSWDIDSGQYIEGFYLYARELHSSEYKMVTLLNKGQGLSSCTVPGLAKASTYEFFLVPFYKSIVGKPSNSRRMRTLEDVPEAPPYGMEAIQFNRTSVFLKWLPPQPNRTRNGILTSYNVVVKGLDVHNTTRIFKNMTIDAATPTLLLANLTTGVTYYIAVAAATRVGVGPFSKPAVLRIDARTQSLDTGYTRYPISRDIADDFLTQTWFIVLLGSIIAIIVFLLGALVLFKRYQFIKQTSLGSLHGNHAIGTVRKFPTLPLNGGGAVGAGGSNSTAAAGQSGHGLWIDPTSGVWRQAAGGGNPGGVGSCTTKEQLPGYAQATAQQGQQPTLLPDYERLSPLNMPDYAEVACSTFKSPTHGAPPMGGGGGGQSASLYDSCGAYATTNVVANVKLYQNRYATKPSQSSGSNNNNHQGNDYQSTGMYSAPPSAHYGCLEPKQQQQQQQPNLMTTSTASTAILTNSPAKVKKINITENKMDQLEGKSERTNPFNQQQQLLLASNALKQGLGAYANTTLAAQMASGGGAGTLRRQRQPKTLYKSENNILGKSGLRQNTMNASVGAPSNGQMDFLTGGPPSEGGDFSGLGLCNSTNQLLNDWASSASIAAPGDYHFGSKQPSKQHLYVKAKDGTWSAVSSDAYQSFKHQQQHHPFLAGSGDNTKSLASVNSLAGDSKFLSSFGSSANV q9vu53_drome caps BcDNA:LD07388 CAPS CT31495 Caps Dmel\CG11282 l(3)02937 l(3)rM632 Dmel_CG11282 CG11282 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSRRRAITMSLAPHLGQAFSLCLCLCLCLVLATLPVALGLANCPNGCECDDDTLMVNCGEGTLDVLPIALNPAIQRLVIKNNKLKTIDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHSLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHNISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEGLVPWADLQTLDLSENPFECDCRLLWLRHLLVSRNASGQYAPVICAYPTALRDLPLAHLAEPLLGCAHGAASKQAIIGILVVACAALITTLALVLYTCRHRIREMLKGHSALGRKEREYQKTFSDEEYMSRPPPGGGGVHPAAGGYPYIAGNSRMIPVTEL q9vxz2_drome Dmel\CG5541 5541 CG32594 CG5541 Dmel_CG5541 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRNIRNLKDPTTWTRILLPFLSCLLLAVQADLVNVTCGEYGNTITCDCNNSDQTMALPSLRGNVYMIEIRNCRDLLVEANRLANTMGLHKVVFRQVGQLVLREHALSVPRYASNKALIVEFEQTNLKLIESHAINGNIEEISFVGGRIELMKPFGFTTTKDSAILLKLDGVTIQRIESQAFKKFAVEQMSIANCQFLGDLPTRAFYELEVTNELSLRGNQFQEVHSHAFSFKLVSKLSLSDNHFLSVDGEWLEAQIRDAATIRGNEFGATSEIAFRSLTVHRSYQLSERLELRFHNNSLRSSRPGADPRVDGTAENVAPQPLQFDNSFALNVRDIRYNNAWSCEQLDRNVEPPLPRAEFFRLHSDQLMFHPPDFGGQGQIQPYIPLRSLITDECRERSYMAFIISGSVLLGLLLLLLILLLWWRVVQKRRRRKLDVVQPEPRTYKETQIVYQIENAGLLKTDL q7jwp9_drome capricious-like 5819 CT18212 Dmel\CG5819 tartan CG5819 Dmel_CG5819 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRIVLELALLVLGVISSCRAVNCPWPCRCTWVVDSLYADCSRRSLQTYPNFDGIPVEHLDLSGNKFLEFPTLYADIDSLIYLDLSSNYISSIGAKTLIGFTSLRTLLLANNSIDSWESLSPNEAFKYAPSLKRLGLDGNRLGSFGNGESFELLTSSSLTDLGLSSCGISSIGGDQMVNQLPNLERLNLANNQLAQIAALPSRTLRVLDLSNCSIKNLSGFFLDAMQNLEALNLSRNTELQFDSLSEDPILTYMLRKLDVSYCNLDSIELSGLPQLTEVRLQGNLLRVVDVNTFANNSMLEVVDLSQNVLRHIGQDAFAKLKRLKELNLAFNEIARLDRNFIRNNDVLVELNLSRNVLQKLTKIVSNSVRTINMSWCEITSIESTALSSLSVIQKLDLSNNLITDMPTFMRSETLQQLNLANCRLTTVRNNTFREFPELADLHLNGNRLTSPIPPNYFDGNKFLDQLWLGDNPWICDCHSPLFVDFYDYLTAKPAKIKDRNHLRCAAPAVFYGKLWEFACADVWILNARTSSTGEKAWSIIMLTLLGLGALVLGYACLQKYLRKRKVRQSDREYEENDDELRRIRDLNERILREEATPSLQHTQEISLLPSYEDALRMPKLVRPVKSMMDLSGPERARNSRKLRRSQTHADGDGSQSEAEDGLQLDSRQRFRSVEMLSNRDKERTAQYGPYRRTGYMEYNQSGSRRFSIEDSRFPAAHLKTQNLQSAEQIGNFQSYENSPYTKRKPKIAEIPPFKRVNMMADSVEFLTDPEYDEVGSKHGSPFAKRKPKPPVLPPPTMKVSAQVYTLQQSPVLELDPAIEDYFSAARKQPSSSTIASDFQELDEPELKSLPDDNRSSTISRSDVEQDLERGKRKKRKNSTSRRVSGSFTAANAAESSSSDSELNALVHKPMRETLF q8swq8_drome CG4232 33143 CG13509 Dmel\CG33143 mdcds_16487 CG33143 Dmel_CG33143 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MFVLIAVLFVNACLAGTIPATPENITVTFLTPTAVRVSWQTQIDLKAHPIEKYIVTYKPTDDSYRVVQDVAGSSEAIVLDRLLPSTQYSLVVTAIWQGKKYRSRGQIKFKTLDLPKNTSQQDFPPGIYGNSSNGARNVTNNASIFGDDVTSTATNTLTHGTTRELPTIRGVEIGIVLIVLMVWAGAIALFFNRWGKIRMLLPYQPDYKHEQLKVPGTGVCSASGCNGQHSHQHIHMLAEEHSTSISERCTRSRINSAIFVSSEGRGFDSIEFLRRHGSQSVLCRKAKSAENITDNGRRKSLRPWRTDDESCKQQHLSQDSNDIELKECGGAGGELLRLPVIHDGKQSPTAVTSLLARSAAITTANMIVGSISLEAPPPYMQDDEGDTLSTAALIHSDAAAVVHESQDSAETVEELVHVPLLASATATASVSASSSPSIAIEAKPRVLVHQRSSTASSSPHSSPKNLGSLGLKIVKPKISAVPMVSVSGPSPPIEKPPLAECL toll_drome Protein toll Tl CG5490 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSRLKAASELALLVIILQLLQWPGSEASFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMCVNAEMPTRMVELSTNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLLWFVTEEDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEKLDEELKAYLKMNTYLKWGDPWFWDKLRFALPHRRPVGNIGNGALIKTALKGSTDDKLELIKPSPVTPPLTTPPAEATKNPLVAQLNGVTPHQAIMIANGKNGLTNLYTPNGKSHGNGHINGAFIINTNAKQSDV q9vr25_drome fipi 15630 CG31970 CT35785 Dmel\CG15630 CG15630 Dmel_CG15630 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRLIGFILNLAALTAVAWANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSPMGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFSDFTKVEKYKTLSLEPRVSSGVKETRNMCVELGVMTLMVLMRPFLG fas2_drome Fasciclin-2 Fasciclin II Fas2 CG3665 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGELPPNSVGVFLALLLCSCSLIELTRAQSPILEIYPKQEVQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTSFEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTRGIDVIQVAERQVFSSAAIVGIAIGGVLLLLFVVDLLCCITVHMGVMATMCRKAKRSPSEIDDEAKLGSGQLVKEPPPSPLPLPPPVKLGGSPMSTPLDEKEPLRTPTGSIKQNSTIEFDGRFVHSRSGEIIGKNSAV q59e14_drome CT35363 33543 CG15354 CG15355 CT35364 Dmel\CG33543 CG33543 Dmel_CG33543 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDTLIALCSLLLLLLSQNAAILGQLDSTSSGGSGTGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNASQFGDYKCKVANPLGMLERVIKLRPGPKPLGPRRFQLKKLYTNGFELDIQTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAGNWSYAKQRDFSFHGGKHFIIPHLETNTTYLMRAASRNLAGLSDWSPVKVFTTAAGCSWSPWLYPSYGLILALIWT impl2_drome Neural/ectodermal development factor IMP-L2 ImpL2 CG15009 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEAKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFVYPVLNEED q59dz1_drome cg15277 CG42313 Dmel_CG42313 side-II 42313 BG:DS01219.3 BG:DS03144.1 BG:SD01219.3 CG15275 CG15276 CG15277 CG33515 CT35222 Dmel\CG42313 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVLLLAMALLMPVTLARLHSTSGVGMSGGGSSMGPGGGGSGSGGISSKDSHVKTKDIDAVEGKSVSLPCPITEPLDNVYMVLWFRDNAGIPLYSFDVRDKESREQPRHWSAPEVFGSRAKFHFDSQPATLEIKRHDQGIYRCRVDFRTSQTQSFRFNLSVIILPEQPIIMDRWGRQLNGTQLGPKQEGDDIVITCRVVGGRPQPQVRWLVNGLLVDNQNEHNSGDVIENRLLWPSVQRNDLNSVFTCQALNTQLDKPKEKSFILDMHLKPLVVKILEPPSSMIADRRYEVSCESSGSRPNAIITWYKGKRQLRRTKDDISKNSTRSELSFVPTTDDDGKSITCRAENPNVNGLYLETMWKLNVVYPPLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKLLWLHNGIHLEHNTSARVIRSNQSLVLQKITKHYAGNYACSAINDEGETVSNQLPLRVKYTPMCKHADRVILIGASKDETVEVVCEIQADPPPRTFRWKFNNSGETLDVGSERFSVNGSRSILKYTPVTDQDYGTLSCWASNEVGTQQHPCLFQVVLAALPNAVSNCTVFNRTELSVDIQCIPGYDGGLPQIFVLEMFSTRTGITRFNLSNAEEALFSLENLDTLTSMMVQENNSLRLRIYSYNQKGRSAAYLLTDFIIGSTAYKTDDDVTLTLSPVIVGSVLTIIIIGVAIAIRIFVVTFVHNLRRNRHHGSKATAAGVTAQPSDVFKGGNLEKPRWQHTDIKTKSSEDLVEDERDPDVIPSQYVGGSSAGSSGSNASNVGSTTAGTATGSSTSTAVVANANAAASAMAGPGGATSSASATDGHQFASGTAAAGGGASKWSPNGNVTTTMLTGDAVNATVTYNQINAQRAQLLAAVAAVGGGCSSTVISPSSSILGGLGKPLGMGMGMGLGMGVGGTVIGSPTSLSSTATLAAHLQPAHSSGVGTLPPGLGSGGGYILNAYASGRLHHPPGGGVPGGATHTATLNRHHHQQQQLHHHPHHQQPHHSGSSLLMGSAGSVMGVVGSTTTATTSCNSSQDLDDNININAIKDCLMTQRVPESCV q0kib0_drome CG34113 side-III 34113 CG10989 CG14677 CG14678 CT34460 Dm_3R:9314 Dmel\CG34113 Dmel_CG34113 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDFPAKRTSTMPLTTSYNANIRRSCLALFALFLFAAHISLTSGQIDWDDDDDPVSTVAVEAVLGRTASLPCDIEPEAKDDRVYMVLWFRESAGKPLYSFDVRGRPFEKALYWSDTNSFGPRAYFVTGQQPAKLSVDNIQLDDEGVYRCRVDFQNSPTRNHRINLTVIVPPHQILVYDASGRDVAGAVGPLLEGDNIVLTCEVRGGRPEPTVTWMNGTRTLEAGSGVSMGRHVTVNRLEVAQISRSALNNTYRCQASNTKLVAPVERSIRIEMLLKPTSVNLTNKLKVFASNTQYNLTCIVAGSVPDTEIKWTQNNRPFKRGLLSTSQSNGRVISTLTFYPQPEDDGTMLKCEGSNPRLQNSAIEDSLMMNVIYPPQVTLSLGSTLRPDDIKEGDDVYFECHIKSNPKEHRIMWSHDGQPVTQNVSWGIIISTRSLVLQRVGRIHSGFYACSAANDRGETQSAPVNLRIRYAPVCSSSSITVIGASLEEDVPIPCRVNSDPPEIDFEWTFSTSGEHFEVPSGHYATIQDPTMTTTSDVRRTVVESNETHFESYVETVSELIYTPKGERDYGTLACYGRNAIGKQSDPCVFQVVPAAKPGALRNCTLRPYVVTSASLNSSNQTTMHANQILPTQYGRHESNYPHMEYVRERHNSSGGNNNGTAPAAGRNNVANKNMRGRTSAGQAKSNNKQLTQQQLQRLKKRTSFTPSQTLAAIERQRQRKQLSQQQQQLQQQHHQATATKSGGDNKPDGSPAKSSKQRMRRASRDPQIQQQQQHQQQQQHQLHAATSITSSQRKQAESNLSTSHLGKGSSSSSRSRRSSSSNINSKSNNGKQPAKYFNKRQKNMHKQKHQQKLKQLKGTTNEHNSNIIHHYAALSSSLRRRKRLAANDILATVAAASTSASLSSPPASSAASLAATATAAVEIEQDVSAVDAPAADSGSNNKRSRKSLTILDKQKQQQEQQQLLPPNAPQISNQPVAAISGNNVKETAATSAHGAVAAGVKDKAPSSKEDSTDNDNDSDGDEDDDDDDDDGAEIDAETETNDEEEDEDEGGEAHDDDADLDEDVAQLATDADYLADGPGDLQEYETVEEVDGQAKHVHMLSLEEQLDLESLEDNVEEEDDGEVDDMYNVSDDDFVASVALSTSDTTAATPLQRTTEGPHIREKATQSQTQTDSATEWQLPHFDYSRMEYSFSNGVVTQSLLGGGAVTGAGHDGFAGGGTINFDNYDNIIYSTMELECMPGYDGGLQQQFFLEAYDSKTMKLRLNMSSTYMDVPVFRIDLSDLMPMDYYPDAHPALHLVVYSVNQKGRSEPIVLENVPINEADKRSDGRMGLSILPLAALLAGTLFTVGIAVLSVVVIAVRRRRGQGARNMCDDKDKHLGMDVTVTAPLETGAGHQRLVVAYTLKQGIEKQPDILSAQKSAPTGGDASSPLGNRPSGLFAGGGGGGGGGGGAAGLASAAPMTGNTGGHKTTDYDGNAPHLNSPPSQSSTLKLESDPAAGGGGLVGARSGGSNPPLLYDAMPTLSRYEQLGLSMASYSAGAGTGGSSSTLSSAGSTVSNAMAANGSAGPGGYAAHLHHTLPHNMAPQRGHDPLNLADYLTTSSLIDYGLNKPPAAHMTLPKGMGLGLGMGLGVGVGAGMGVGPGPGMGMGMASTMAGTSLSPSQLNTITHKSAAGRNHIITDTLPGPESCV q9w213_drome robo-1 robo1 BEST:GM07780 CT32892 D-Robo1 Dmel\CG13521 ROBO Robo Robo-1 Robo1 dRobo dRobo1 robo robo1S roundabout CG13521 Dmel_CG13521 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHPMHPENHAIARSTSTTNNPSRSRSSRMWLLPAWLLLVLVASNGLPAVRGQYQSPRIIEHPTDLVVKKNEPATLNCKVEGKPEPTIEWFKDGEPVSTNEKKSHRVQFKDGALFFYRTMQGKKEQDGGEYWCVAKNRVGQAVSRHASLQIAVLRDDFRVEPKDTRVAKGETALLECGPPKGIPEPTLIWIKDGVPLDDLKAMSFGASSRVRIVDGGNLLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIPVSRARILHDEKSLEISNITPTDEGTYVCEAHNNVGQISARASLIVHAPPNFTKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQEDEGYYVCSAFSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFHDGHAVQAGNRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEKPGSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDLQTGWIVAAQRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSGLSNTIKTIEADFDAASANDLSAARTLLTGKSVELIDASAINASAVRLEWMLHVSADEKYVEGLRIHYKDASVPSAQYHSITVMDASAESFVVGNLKKYTKYEFFLTPFFETIEGQPSNSKTALTYEDVPSAPPDNIQIGMYNQTAGWVRWTPPPSQHHNGNLYGYKIEVSAGNTMKVLANMTLNATTTSVLLNNLTTGAVYSVRLNSFTKAGDGPYSKPISLFMDPTHHVHPPRAHPSGTHDGRHEGQDLTYHNNGNIPPGDINPTTHKKTTDYLSGPWLMVLVCIVLLVLVISAAISMVYFKRKHQMTKELGHLSVVSDNEITALNINSKESLWIDHHRGWRTADTDKDSGLSESKLLSHVNSSQSNYNNSDGGTDYAEVDTRNLTTFYNCRKSPDNPTPYATTMIIGTSSSETCTKTTSISADKDSGTHSPYSDAFAGQVPAVPVVKSNYLQYPVEPINWSEFLPPPPEHPPPSSTYGYAQGSPESSRKSSKSAGSGISTNQSILNASIHSSSSGGFSAWGVSPQYAVACPPENVYSNPLSAVAGGTQNRYQITPTNQHPPQLPAYFATTGPGGAVPPNHLPFATQRHAASEYQAGLNAARCAQSRACNSCDALATPSPMQPPPPVPVPEGWYQPVHPNSHPMHPTSSNHQIYQCSSECSDHSRSSQSHKRQLQLEEHGSSAKQRGGHHRRRAPVVQPCMESENENMLAEYEQRQYTSDCCNSSREGDTCSCSEGSCLYAEAGEPAPRQMTAKNT slit_drome Protein slit sli CG43758 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAAPSRTTLMPPPFRLQLRLLILPILLLLRHDAVHAEPYSGGFGSSAVSSGGLGSVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSSENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRNDILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEEGRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTHYSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQTSPCQNHECKHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLRTRPEANVTIVFSSAEQNGILMYDGQDAHLAVELFNGRIRVSYDVGNHPVSTMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGNAQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY q9gpp7_drome robo2 lea CG5481 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPVDRSRRAVFPLLLLLAGLNGLTQVGALKGENPRIIEHPMDTTVPKNDPFTFNCQAEGNPTPTIQWFKDGRELKTDTGSHRIMLPAGGLFFLKVIHSRRESDAGTYWCEAKNEFGVARSRNATLQVAFLRDEFRLEPANTRVAQGEVALMECGAPRGSPEPQISWRKNGQTLNLVGNKRIRIVDGGNLAIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVRPFLIRGPQNQTAVVGSSVVFQCRIGGDPLPDVLWRRTASGGNMPLRRVHVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATGILTVHAPPKFVIRPKNQLVEIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDGRMEVTLTPEGRSVLSIARFAREDSGKVVTCNALNAVGSVSSRTVVSVDTQFELPPPIIEQGPVNQTLPVKSIVVLPCRTLGTPVPQVSWYLDGIPIDVQEHERRNLSDAGALTISDLQRHEDEGLYTCVASNRNGKSSWSGYLRLDTPTNPNIKFFRAPELSTYPGPPGKPQMVEKGENSVTLSWTRSNKVGGSSLVGYVIEMFGKNETDGWVAVGTRVQNTTFTQTGLLPGVNYFFLIRAENSHGLSLPSPMSEPITVGTRYFNSGLDLSEARASLLSGDVVELSNASVVDSTSMKLTWQIINGKYVEGFYVYARQLPNPIVNNPAPVTSNTNPLLGSTSTSASASASASALISTKPNIAAAGKRDGETNQSGGGAPTPLNTKYRMLTILNGGGASSCTITGLVQYTLYEFFIVPFYKSVEGKPSNSRIARTLEDVPSEAPYGMEALLLNSSAVFLKWKAPELKDRHGVLLNYHVIVRGIDTAHNFSRILTNVTIDAASPTLVLANLTEGVMYTVGVAAGNNAGVGPYCVPATLRLDPITKRLDPFINQRYPINQDHVNDVLTQPWFIILLGAILAVLMLSFGAMVFVKRKHMMMKQSALNTMRGNHTSDVLKMPSLSARNGNGYWLDSSTGGMVWRPSPGGDSLEMQKDHIADYAPVCGAPGSPAGGGTSSGGSGGAGSGASGGDDIHGGHGSERNQQRYVGEYSNIPTDYAEVSSFGKAPSEYGRHGNASPAPYATSSILSPHQQQQQQQPRYQQRPVPGYGLQRPMHPHYQQQQHQQQQAQQTHQQHQALQQHQQLPPSNIYQQMSTTSEIYPTNTGPSRSVYSEQYYYPKDKQRHIHITENKLSNCHTYEAAPGAKQSSPISSQFASVRRQQLPPNCSIGRESARFKVLNTDQGKNQQNLLDLDGSSMCYNGLADSGCGGSPSPMAMLMSHEDEHALYHTADGDLDDMERLYVKVDEQQPPQQQQQLIPLVPQHPAEGHLQSWRNQSTRSSRKNGQECIKEPSELIYAPGSVASERSLLSNSGSGTSSQPAGHNV q9vfu7-18w-1 1425085 n/a 1425088 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425089 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425182 1425178 physical association physical association false false false Fig. 1, Supp. Table 2 q9vfu7-18w 1425085 n/a 1425089 unspecified role unspecified role prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425088 unspecified role unspecified role bait bait region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425189 1425186 physical association physical association false false false Fig. 1, Supp. Table 2 q9vfu7-beat_iia 1425085 n/a 1425090 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425088 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425195 1425193 physical association physical association false false false Fig. 1, Supp. Table 2 beat_iia-q9vfu7 1425085 n/a 1425090 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425088 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425203 1425200 physical association physical association false false false Fig. 1, Supp. Table 2 beat_iia-side 1425085 n/a 1425090 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425091 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425209 1425207 physical association physical association false false false Fig. 1, Supp. Table 2 side-beat_iia 1425085 n/a 1425090 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425091 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425216 1425213 physical association physical association false false false Fig. 1, Supp. Table 2 beat_iib-q9vfu7 1425085 n/a 1425092 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425088 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425223 1425221 physical association physical association false false false Fig. 1, Supp. Table 2 q9vfu7-beat_iib 1425085 n/a 1425092 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425088 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425231 1425227 physical association physical association false false false Fig. 1, Supp. Table 2 beat_iib-side 1425085 n/a 1425092 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425091 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425238 1425234 physical association physical association false false false Fig. 1, Supp. Table 2 side-beat_iib 1425085 n/a 1425092 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425091 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425245 1425242 physical association physical association false false false Fig. 1, Supp. Table 2 dscam2-dscam2 1425085 n/a 1425093 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425093 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425251 1425248 physical association physical association false false false Fig. 1, Supp. Table 2 dscam2-dscam2-1 1425085 n/a 1425094 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425094 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425258 1425255 physical association physical association false false false Fig. 1, Supp. Table 2 q9w259-q9ve49 1425085 n/a 1425095 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425096 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425266 1425263 physical association physical association false false false Fig. 1, Supp. Table 2 q9ve49-q9w259 1425085 n/a 1425095 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425096 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425272 1425270 physical association physical association false false false Fig. 1, Supp. Table 2 q9ve49-q9w128 1425085 n/a 1425095 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425097 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425279 1425277 physical association physical association false false false Fig. 1, Supp. Table 2 q9w128-q9ve49 1425085 n/a 1425095 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425097 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425287 1425283 physical association physical association false false false Fig. 1, Supp. Table 2 beat_ia-side 1425085 n/a 1425091 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425098 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425293 1425291 physical association physical association false false false Fig. 1. Supp. Table 2 side-beat_ia 1425085 n/a 1425091 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425098 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425300 1425297 physical association physical association false false false Fig. 1. Supp. Table 2 beat_iv-q9vh85 1425085 n/a 1425099 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425100 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425308 1425305 physical association physical association false false false Fig. 1 Supp Table 2 q9vh85-beat_iv 1425085 n/a 1425099 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425100 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425314 1425312 physical association physical association false false false Fig. 1 Supp Table 2 q0ki85-beatva 1425085 n/a 1425101 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-salivary_gland Drosophila melanogaster Salivary gland salivary_gland Salivary gland n/a 1425102 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425322 1425318 physical association physical association false false false Fig. 1 Supp Table 2 beat_va-q0ki85 1425085 n/a 1425101 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425102 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425329 1425325 physical association physical association false false false Fig. 1 Supp Table 2 beat_vb-q0ki85 1425085 n/a 1425103 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425101 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425335 1425333 physical association physical association false false false Fig. 1 Supp Table 2 q0ki85-beat_vb 1425085 n/a 1425103 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425101 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425343 1425340 physical association physical association false false false Fig. 1 Supp Table 2 beat_vc-q0ki85 1425085 n/a 1425101 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425104 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false [EBI-6881602] The range 18-261 was N-terminal and is not anymore. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425350 1425347 physical association physical association false false false Fig. 1 Supp Table 2 q0ki85-q9vh85 1425085 n/a 1425101 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425104 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false [EBI-6881608] The range 18-261 was N-terminal and is not anymore. region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425356 1425354 physical association physical association false false false Fig. 1 Supp Table 2 q9vh85-q7kuk9 1425085 n/a 1425100 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425105 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425363 1425360 physical association physical association false false false Fig. 1 Supp Table 2 q7kuk9-q9vh85 1425085 n/a 1425105 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425100 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425370 1425368 physical association physical association false false false Fig. 1 Supp Table 2 q0ki85-hig 1425085 n/a 1425101 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425106 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425378 1425375 physical association physical association false false false Fig. 1 Supp Table 2 hig-q0ki85 1425085 n/a 1425106 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425101 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425384 1425382 physical association physical association false false false Fig. 1 Supp Table 2 q9vdd5-q9vmn9 1425085 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425108 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425392 1425389 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn9-q9vdd5 1425085 n/a 1425108 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425399 1425396 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-q9var6 1425085 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425109 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425406 1425403 physical association physical association false false false Fig. 1, Supp. Table 2 q9var6-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425109 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425412 1425410 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-q9vmn6 1425085 n/a 1425110 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425420 1425417 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn6-q9vdd5 1425085 n/a 1425110 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425427 1425423 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-cg31708_ra 1425085 n/a 1425107 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425111 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425433 1425430 physical association physical association false false false Fig. 1, Supp. Table 2 cg31708_ra-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425111 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425440 1425437 physical association physical association false false false Fig. 1, Supp. Table 2 a8jnc7-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425112 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425448 1425444 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-a8jnc7 1425085 n/a 1425112 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425107 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425454 1425451 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-b7z153 1425085 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425113 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425461 1425459 physical association physical association false false false Fig. 1, Supp. Table 2 b7z153-q9vdd5 1425085 n/a 1425113 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425469 1425466 physical association physical association false false false Fig. 1, Supp. Table 2 a4ij70-q9vdd5 1425085 n/a 1425114 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425107 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425475 1425473 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-a4ij70 1425085 n/a 1425114 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425107 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425482 1425480 physical association physical association false false false Fig. 1, Supp. Table 2 q9var6-q9vr83 1425085 n/a 1425109 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425115 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425489 1425486 physical association physical association false false false Fig. 1, Supp. Table 2 q9vr83-q9var6 1425085 n/a 1425115 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425109 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425497 1425493 physical association physical association false false false Fig. 1, Supp. Table 2 dpr-q9vdd5 1425085 n/a 1425116 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425107 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425503 1425500 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr 1425085 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425116 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425510 1425508 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn9-dpr 1425085 n/a 1425108 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425116 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425517 1425514 physical association physical association false false false Fig. 1, Supp. Table 2 dpr-q9vmn9 1425085 n/a 1425108 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425116 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425524 1425522 physical association physical association false false false Fig. 1, Supp. Table 2 dpr-q9vmn6 1425085 n/a 1425116 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425110 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425532 1425529 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn6-dpr 1425085 n/a 1425110 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425116 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr10 1425085 n/a 1425107 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425117 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425546 1425542 physical association physical association false false false Fig. 1, Supp. Table 2 dpr10-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425117 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425552 1425550 physical association physical association false false false Fig. 1, Supp. Table 2 dpr10-cg13020 1425085 n/a 1425117 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425118 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425559 1425556 physical association physical association false false false Fig. 1, Supp. Table 2 cg13020-dpr10 1425085 n/a 1425118 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425117 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425566 1425564 physical association physical association false false false Fig. 1, Supp. Table 2 dpr11-q9vdd5 1425085 n/a 1425119 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425107 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425573 1425570 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr11 1425085 n/a 1425119 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association false false false Fig. 1, Supp. Table 2 q9var6-dpr11 1425085 n/a 1425109 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425119 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425588 1425584 physical association physical association false false false Fig. 1, Supp. Table 2 dpr11-q9var6 1425085 n/a 1425119 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425109 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425595 1425592 physical association physical association false false false Fig. 1, Supp. Table 2 dpr11-b7z153 1425085 n/a 1425113 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425119 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425601 1425599 physical association physical association false false false Fig. 1, Supp. Table 2 b7z153-dpr11 1425085 n/a 1425119 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425113 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425608 1425605 physical association physical association false false false Fig. 1, Supp. Table 2 dpr12-q9vdd5 1425085 n/a 1425120 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425107 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425615 1425612 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr12 1425085 n/a 1425120 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425623 1425620 physical association physical association false false false Fig. 1, Supp. Table 2 dpr12-a8jnc7 1425085 n/a 1425120 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425112 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425630 1425627 physical association physical association false false false Fig. 1, Supp. Table 2 a8jnc7-dpr12 1425085 n/a 1425112 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425120 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425636 1425634 physical association physical association false false false Fig. 1, Supp. Table 2 dpr13-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425121 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425643 1425641 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr13 1425085 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425121 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425650 1425648 physical association physical association false false false Fig. 1, Supp. Table 2 cg31708_ra-dpr13 1425085 n/a 1425111 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425121 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425658 1425655 physical association physical association false false false Fig. 1, Supp. Table 2 dpr13-cg31708_ra 1425085 n/a 1425121 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425111 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425664 1425661 physical association physical association false false false Fig. 1, Supp. Table 2 dpr13-a4ij70 1425085 n/a 1425114 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425121 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425672 1425668 physical association physical association false false false Fig. 1, Supp. Table 2 a4ij70-dpr13 1425085 n/a 1425121 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425114 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425679 1425676 physical association physical association false false false Fig. 1, Supp. Table 2 dpr14-a4ij70 1425085 n/a 1425114 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425122 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425686 1425683 physical association physical association false false false Fig. 1, Supp. Table 2 a4ij70-dpr14 1425085 n/a 1425114 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425122 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425693 1425690 physical association physical association false false false Fig. 1, Supp. Table 2 dpr16-q9var6 1425085 n/a 1425109 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425123 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425700 1425696 physical association physical association false false false Fig. 1, Supp. Table 2 q9var6-dpr16 1425085 n/a 1425109 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425123 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425706 1425703 physical association physical association false false false Fig. 1, Supp. Table 2 cg31708_ra-dpr16 1425085 n/a 1425123 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425111 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425713 1425711 physical association physical association false false false Fig. 1, Supp. Table 2 dpr16-cg31708_ra 1425085 n/a 1425111 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425123 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425720 1425717 physical association physical association false false false Fig. 1, Supp. Table 2 dpr16-a4ij70 1425085 n/a 1425114 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425123 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425728 1425725 physical association physical association false false false Fig. 1, Supp. Table 2 a4ij70-dpr16 1425085 n/a 1425114 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425123 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425734 1425731 physical association physical association false false false Fig. 1, Supp. Table 2 dpr17-q9var6 1425085 n/a 1425109 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425124 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425742 1425739 physical association physical association false false false Fig. 1, Supp. Table 2 q9var6-dpr17 1425085 n/a 1425124 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425109 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425748 1425746 physical association physical association false false false Fig. 1, Supp. Table 2 dpr17-a4ij70 1425085 n/a 1425124 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425114 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425755 1425753 physical association physical association false false false Fig. 1, Supp. Table 2 a4ij70-dpr17 1425085 n/a 1425124 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425114 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425762 1425760 physical association physical association false false false Fig. 1, Supp. Table 2 dpr19-q9vdd5-1 1425085 n/a 1425125 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425770 1425766 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr19 1425085 n/a 1425125 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425107 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425776 1425773 physical association physical association false false false Fig. 1, Supp. Table 2 dpr19-cg31708_ra 1425085 n/a 1425125 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425111 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425784 1425781 physical association physical association false false false Fig. 1, Supp. Table 2 cg31708_ra-dpr19 1425085 n/a 1425125 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425111 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425791 1425787 physical association physical association false false false Fig. 1, Supp. Table 2 dpr19-a4ij70 1425085 n/a 1425114 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425125 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425797 1425795 physical association physical association false false false Fig. 1, Supp. Table 2 a4ij70-dpr19 1425085 n/a 1425125 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425114 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425804 1425801 physical association physical association false false false Fig. 1, Supp. Table 2 dpr2-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425126 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425811 1425808 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr2 1425085 n/a 1425126 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425107 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association false false false Fig. 1, Supp. Table 2 dpr2-q9vmn9 1425085 n/a 1425108 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425126 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425825 1425822 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn9-dpr2 1425085 n/a 1425126 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425108 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425832 1425830 physical association physical association false false false Fig. 1, Supp. Table 2 dpr2-q9vmn6 1425085 n/a 1425126 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425110 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425840 1425837 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn6-dpr2 1425085 n/a 1425126 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425110 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425846 1425844 physical association physical association false false false Fig. 1, Supp. Table 2 cg31708_ra-dpr20 1425085 n/a 1425127 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425111 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425853 1425851 physical association physical association false false false Fig. 1, Supp. Table 2 dpr20-cg31708_ra 1425085 n/a 1425111 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425127 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425860 1425857 physical association physical association false false false Fig. 1, Supp. Table 2 dpr20-a4ij70 1425085 n/a 1425114 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425127 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425868 1425864 physical association physical association false false false Fig. 1, Supp. Table 2 a4ij70-dpr20 1425085 n/a 1425114 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425127 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association false false false Fig. 1, Supp. Table 2 dpr3-q9vmn9 1425085 n/a 1425108 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425128 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425881 1425878 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn9-dpr3 1425085 n/a 1425108 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425128 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425889 1425886 physical association physical association false false false Fig. 1, Supp. Table 2 dpr3-q9vmn6 1425085 n/a 1425128 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425110 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425896 1425893 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn6-dpr3 1425085 n/a 1425128 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425110 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425902 1425900 physical association physical association false false false Fig. 1, Supp. Table 2 dpr7-dpr3 1425085 n/a 1425129 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425128 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425909 1425907 physical association physical association false false false Fig. 1, Supp. Table 2 dpr3-dpr7 1425085 n/a 1425129 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425128 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425916 1425913 physical association physical association false false false Fig. 1, Supp. Table 2 dpr5-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425130 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425924 1425921 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr5 1425085 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425130 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425930 1425928 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn6-dpr5 1425085 n/a 1425130 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425110 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425938 1425935 physical association physical association false false false Fig. 1, Supp. Table 2 dpr5-q9vmn6 1425085 n/a 1425110 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425130 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425945 1425942 physical association physical association false false false Fig. 1, Supp. Table 2 dpr5-dpr6 1425085 n/a 1425131 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425130 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425951 1425948 physical association physical association false false false Fig. 1, Supp. Table 2 dpr6-dpr5 1425085 n/a 1425130 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425131 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425959 1425955 physical association physical association false false false Fig. 1, Supp. Table 2 dpr6-q9vdd5 1425085 n/a 1425131 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1425966 1425963 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr6 1425085 n/a 1425131 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association false false false Fig. 1, Supp. Table 2 dpr6-cg31708_ra 1425085 n/a 1425111 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425131 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425979 1425976 physical association physical association false false false Fig. 1, Supp. Table 2 cg31708_ra-dpr6 1425085 n/a 1425131 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425111 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425987 1425983 physical association physical association false false false Fig. 1, Supp. Table 2 dpr6-cg13020 1425085 n/a 1425118 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425131 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1425994 1425991 physical association physical association false false false Fig. 1, Supp. Table 2 cg13020-dpr6 1425085 n/a 1425118 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425131 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426000 1425998 physical association physical association false false false Fig. 1, Supp. Table 2 dpr6-b7z153 1425085 n/a 1425113 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425131 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426007 1426004 physical association physical association false false false Fig. 1, Supp. Table 2 b7z153-dpr6 1425085 n/a 1425131 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425113 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426014 1426012 physical association physical association false false false Fig. 1, Supp. Table 2 dpr6-a4ij70 1425085 n/a 1425131 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425114 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426021 1426019 physical association physical association false false false Fig. 1, Supp. Table 2 a4ij70-dpr6 1425085 n/a 1425131 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425114 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426029 1426026 physical association physical association false false false Fig. 1, Supp. Table 2 dpr7-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425129 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426036 1426033 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr7 1425085 n/a 1425107 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425129 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426042 1426040 physical association physical association false false false Fig. 1, Supp. Table 2 dpr7-q9vmn9 1425085 n/a 1425129 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425108 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426050 1426047 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn9-dpr7 1425085 n/a 1425108 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425129 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426056 1426054 physical association physical association false false false Fig. 1, Supp. Table 2 dpr7-q9vmn6 1425085 n/a 1425129 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425110 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426064 1426060 physical association physical association false false false Fig. 1, Supp. Table 2 q9vmn6-dpr7 1425085 n/a 1425129 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425110 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426070 1426068 physical association physical association false false false Fig. 1, Supp. Table 2 dpr8-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425132 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426077 1426075 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr8 1425085 n/a 1425107 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425132 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426084 1426081 physical association physical association false false false Fig. 1, Supp. Table 2 dpr8-b7z153 1425085 n/a 1425132 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425113 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426092 1426088 physical association physical association false false false Fig. 1, Supp. Table 2 b7z153-dpr8 1425085 n/a 1425113 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425132 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426099 1426095 physical association physical association false false false Fig. 1, Supp. Table 2 dpr9-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425133 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426105 1426102 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-dpr9 1425085 n/a 1425133 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425107 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426112 1426110 physical association physical association false false false Fig. 1, Supp. Table 2 dpr9-b7z153 1425085 n/a 1425113 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425133 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426119 1426116 physical association physical association false false false Fig. 1, Supp. Table 2 b7z153-dpr9 1425085 n/a 1425133 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425113 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426127 1426124 physical association physical association false false false Fig. 1, Supp. Table 2 klg-klg 1425085 n/a 1425134 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425134 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426133 1426130 physical association physical association false false false Fig. 1, Supp. Table 2 q9vdd5-klg 1425085 n/a 1425134 unspecified role unspecified role prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425107 unspecified role unspecified role bait bait region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426141 1426138 physical association physical association false false false Fig. 1, Supp. Table 2 klg-q9vdd5 1425085 n/a 1425107 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425134 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association false false false Fig. 1, Supp. Table 2 hbs-kirre-1 1425085 n/a 1425135 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425136 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426155 1426151 physical association physical association false false false Fig. 1, Supp. Table 2 kirre-hbs 1425085 n/a 1425136 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425135 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426161 1426158 physical association physical association false false false Fig. 1, Supp. Table 2 rst-hbs 1425085 n/a 1425136 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425137 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426168 1426166 physical association physical association false false false Fig. 1, Supp. Table 2 hbs-rst 1425085 n/a 1425136 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425137 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426175 1426173 physical association physical association false false false Fig. 1, Supp. Table 2 dscam-dscam 1425085 n/a 1425138 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425138 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426182 1426179 physical association physical association false false false Fig. 1, Supp. Table 2 netb-fra 1425085 n/a 1425139 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425140 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426190 1426187 physical association physical association false false false Fig. 1, Supp. Table 2 fra-netb 1425085 n/a 1425140 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425139 unspecified role unspecified role bait bait region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426197 1426194 physical association physical association false false false Fig. 1, Supp. Table 2 ihog-vn 1425085 n/a 1425141 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425142 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426203 1426200 physical association physical association false false false Fig. 1, Supp. Table 2 vn-ihog 1425085 n/a 1425142 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425141 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426211 1426208 physical association physical association false false false Fig. 1, Supp. Table 2 ama-ama-1 1425085 n/a 1425143 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425143 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426217 1426214 physical association physical association false false false Fig. 1, Supp. Table 2 nrm-q9w1h6 1425085 n/a 1425144 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425145 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426224 1426221 physical association physical association false false false Fig. 1, Supp. Table 2 q9w1h6-nrm 1425085 n/a 1425144 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 5.0 n/a 1425145 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426232 1426228 physical association physical association false false false Fig. 1, Supp. Table 2 vn-boi 1425085 n/a 1425146 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425142 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426239 1426236 physical association physical association false false false Fig. 1, Supp. Table 2, Supp. Fig. 4B boi-vn 1425085 n/a 1425146 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425142 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426245 1426242 physical association physical association false false false Fig. 1, Supp. Table 2 boi-boi 1425085 n/a 1425146 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425146 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426252 1426249 physical association physical association false false false Fig. 1, Supp. Table 2 fred-fred 1425085 n/a 1425147 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425147 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426259 1426256 physical association physical association false false false Fig. 1, Supp. Table 2 fred-ed 1425085 n/a 1425147 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425148 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426267 1426264 physical association physical association false false false Fig. 1, Supp. Table 2 ed-ed 1425085 n/a 1425148 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425148 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426274 1426271 physical association physical association false false false Fig. 1, Supp. Table 2 dscam3-dscam3-1 1425085 n/a 1425149 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425149 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426281 1426278 physical association physical association false false false Fig. 1, Supp. Table 2 dscam4-dscam4 1425085 n/a 1425150 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425150 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426287 1426285 physical association physical association false false false Fig. 1, Supp. Table 2 ptp99a-ptp99a 1425085 n/a 1425151 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425151 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426294 1426291 physical association physical association false false false Fig. 1, Supp. Table 2 Described isoform is not in UniProt (July 2013). kirre-sns 1425085 n/a 1425152 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425135 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426301 1426299 physical association physical association false false false Fig. 1, Supp. Table 2 sns-kirre 1425085 n/a 1425152 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425135 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426308 1426305 physical association physical association false false false Fig. 1, Supp. Table 2 unc_5-sns 1425085 n/a 1425152 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425153 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426315 1426312 physical association physical association false false false Fig. 1, Supp. Table 2 sns-unc_5 1425085 n/a 1425152 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425153 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 physical association physical association false false false Fig. 1, Supp. Table 2 ed-tutl 1425085 n/a 1425148 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425154 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426329 1426326 physical association physical association false false false Fig. 1, Supp. Table 2 tutl-ed 1425085 n/a 1425148 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425154 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426336 1426333 physical association physical association false false false Fig. 1, Supp. Table 2 fas3-fas3 1425085 n/a 1425155 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425155 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426344 1426341 physical association physical association false false false Fig. 1, Supp. Table 2 sns-rst 1425085 n/a 1425152 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425137 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426350 1426347 physical association physical association false false false Fig. 1, Supp. Table 2 rst-sns 1425085 n/a 1425137 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425152 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426357 1426355 physical association physical association false false false Fig. 1, Supp. Table 2 rst-rst 1425085 n/a 1425137 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425137 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 physical association physical association false false false Fig. 1, Supp. Table 2 kek1-egfr 1425085 n/a 1425156 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425157 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association false false false Fig. 1, Supp. Table 2 egfr-kek1 1425085 n/a 1425156 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425157 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426379 1426376 physical association physical association false false false Fig. 1, Supp. Table 2 lac-lac-1 1425085 n/a 1425158 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425158 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426385 1426382 physical association physical association false false false Fig. 1, Supp. Table 2 lac-q9vgh2 1425085 n/a 1425158 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425159 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426392 1426389 physical association physical association false false false Fig. 1, Supp. Table 2 q9vgh2-lac 1425085 n/a 1425158 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425159 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426400 1426397 physical association physical association false false false Fig. 1, Supp. Table 2 pqbp_1-pqbp_1 1425085 n/a 1425160 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425160 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426406 1426403 physical association physical association false false false Fig. 1, Supp. Table 2 robo3-robo3 1425085 n/a 1425161 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425161 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426413 1426411 physical association physical association false false false Fig. 1, Supp. Table 2 be-caps-1 1425085 n/a 1425162 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425163 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426420 1426417 physical association physical association false false false Fig. 1, Supp. Table 2 caps-be 1425085 n/a 1425162 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425163 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426428 1426425 physical association physical association false false false Fig. 1, Supp. Table 2 q9vr83-q7jwp9 1425085 n/a 1425115 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425164 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426434 1426432 physical association physical association false false false Fig. 1, Supp. Table 2 q7jwp9-q9vr83 1425085 n/a 1425115 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425164 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426441 1426438 physical association physical association false false false Fig. 1, Supp. Table 2 cg4232-cg4232 1425085 n/a 1425165 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425165 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426449 1426446 physical association physical association false false false Fig. 1, Supp. Table 2 tl-tl-1 1425085 n/a 1425166 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425166 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426456 1426452 physical association physical association false false false Fig. 1, Supp. Table 2 fas2-q9vr25-1 1425085 n/a 1425167 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425168 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426462 1426459 physical association physical association false false false Fig. 1, Supp. Table 2 q9vr25-fas2 1425085 n/a 1425167 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425168 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426470 1426466 physical association physical association false false false Fig. 1, Supp. Table 2 q59e14-fas2 1425085 n/a 1425169 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425168 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426477 1426474 physical association physical association false false false Fig. 1, Supp. Table 2 fas2-q59e14 1425085 n/a 1425168 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425169 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 1426484 1426480 physical association physical association false false false Fig. 1, Supp. Table 2 fas2-fas2 1425085 n/a 1425168 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425168 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426490 1426487 physical association physical association false false false Fig. 1, Supp. Table 2 impl2-impl2 1425085 n/a 1425170 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425170 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426497 1426494 physical association physical association false false false Fig. 1, Supp. Table 2 ed-fred 1425085 n/a 1425148 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1425147 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 physical association physical association false false false Fig. 1, Supp. Table 2 q0kib0-q59dz1 1425085 n/a 1425171 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425172 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426511 1426509 physical association physical association false false false Fig. 1, Supp Table 2 q59dz1-q0kib0 1425085 n/a 1425172 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425171 unspecified role unspecified role bait bait region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 1426519 1426516 physical association physical association false false false Fig. 1, Supp Table 2 beat_ia-side-2 1425086 n/a 1425091 unspecified role unspecified role unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1425098 unspecified role unspecified role unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 1426526 1426523 direct interaction direct interaction false false false Fig. 4D. q9vh85-beat_iv-1 1425086 n/a 1425100 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1425099 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 1426534 1426529 direct interaction direct interaction false false false 1425086 Fig. 4D, Supp Fig. 5A beat_iv-q9vh85-1 1425086 n/a 1425100 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1425099 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 1426541 1426538 direct interaction direct interaction false false false 1425086 Fig. 4D, Supp Fig. 5A dpr6-cg13020-1 1425086 n/a 1425131 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1425118 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 1426549 1426546 direct interaction direct interaction false false false 1425086 Fig. 4D, Supp. Fig. 5C vn-boi-1 1425086 n/a 1425142 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1425146 unspecified role unspecified role prey prey region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 1426558 1426554 direct interaction direct interaction false false false 1425086 Fig. 4D, Supp Fig. 5D dpr6-q9vdd5-2 1425086 n/a 1425107 unspecified role unspecified role unspecified role unspecified role extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1425131 unspecified role unspecified role unspecified role unspecified role extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 1426564 1426562 direct interaction direct interaction false false false 1425086 4D sns-unc_5-1 1425086 n/a 1425152 unspecified role unspecified role unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1425153 unspecified role unspecified role unspecified role unspecified role extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 1426571 1426569 direct interaction direct interaction false false false 1425086 Fig. 4D fas2-fas2-2 1425087 n/a 1425168 unspecified role unspecified role neutral component neutral component drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. n/a 1425168 unspecified role unspecified role neutral component neutral component region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 physical association physical association false false false Fig. 5, Supp. Fig. 6 In embryos heterozygous for a null mutation, fas2EB112, Fas2-AP5 staining intensity is reduced , and there is no staining in fas2EB112 hemizygous embryos, which completely lack Fas2 protein robo-sli-1 1425087 n/a 1425173 unspecified role unspecified role neutral component neutral component extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425174 unspecified role unspecified role neutral component neutral component drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. physical association physical association false false false Supp. Fig. 7 Interaction not observed in sli-/- cells. lea-sli-1 1425087 n/a 1425174 unspecified role unspecified role neutral component neutral component drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. n/a 1425175 unspecified role unspecified role neutral component neutral component extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range false region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 physical association physical association false false false Supp. Fig. 7 Interaction not observed in sli-/- cells. robo3-sli-1 1425087 n/a 1425161 unspecified role unspecified role neutral component neutral component region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. Stoichiometry: 5.0 n/a 1425174 unspecified role unspecified role neutral component neutral component drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. physical association physical association false false false Supp. Fig. 7 Interaction not observed in sli-/- cells.