MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint li-2013h-4 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation li-2013h-1 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation li-2013h-2 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation li-2013h-3 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation li-2013h-5 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation q5zus4_legph legAS4 lpg1718 protein protein legph Legionella pneumophila subsp. pneumophila MIILYDFLQESSVMPRSKNDSKLKKKSALQSKFKEQQLNHGSKEHKSKFKFSQRKAKKKGPGMTHLPGNIYTLFTPVNGPKSKDEWIDTSKIMLDLHIDNMSSSDYIPSAIDRTDLVMVQSVHLLRKTGGRGLFAREDIPKGTCIGIYTGEVYSEQEFEQYLKEHVGSDKSYAMYVGGRVIDAARKGNLTRYINFSDSQDNAEFVETTLNRKKVAKVITTKNIKAGQQLLINYNTYEEQASRYYYFLNPGDGWLSAQEFYQTYQSQYRLEQMPYNLEGFDLKAGDRVLMTQIGRIILANYSLAKEQELNASDIDLPFLKVGSDEKILDFDEADTFTPLMAACYLGQVENVKWLIEHGANIDQQQSHSGHCPLSLTLKGYSLAKDTQKYIDIIQLLIKNQVNLLVHDRSDKTFLHNAALVLNNLDFQSVVKFLIGQNPIDINEYFTYIDENDFDIVMHCYNNKLFDKALVLLAFYPDYFKRNYMSDNEGHNQFNINAFRKAIKDFNSNERSILLMQLRESGLHLPEDLLEQLGIMDSSITLESKFF cbx5_human Chromobox protein homolog 5 CBX5 Heterochromatin protein 1 homolog alpha Antigen p25 HP1A protein protein human Homo sapiens Human MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS npm_human Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Numatrin Nucleolar protein NO38 protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL a0a0h3lym0_borbr BB4970 protein protein borbr Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) Alcaligenes bronchisepticus MTEIIKPWHSVRRSRLHGNGVFATRKIPAGTRIIEYGGKRISAAEADRRHPTNPDDPFHTFFFSLSSGRVIDGGDEGNDARWINHSCDPNCEAQEGRHGKRVYIVALRDIARGEELFYDYGLVLDGRITRKLKEGYRCLCGTTPCRGTMLALPEKKKTKARSAEKA q2stb6_burta BTH_I3341 protein protein burta Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) MRRSARRRSTGVRSRASTRRCSATYRSASVERRARRMEAGRRRAARMPISSAPIRLPMRPIFRQLRGFRATSRIARPFDVERSNPERVGFGDSNPSRRAACQPYTARRAKPRGRHAMRGAIVSVSSRHQRIRSMSSRRIVVRRSGVHGKGVFAAVPIKAGERVVEYKGERISWKEALRRHPHDPNDPNHTFYFALEEGGVIDGKIDGNSARWINHSCAPNCEAEEVDGRVYIHALRDIGEQEELFYDYGLVIDARLTKKLKREYACHCGAATCRGTLLATSEDDEGKKKKKAKKGGKDKKKKK cbx3_human Chromobox protein homolog 3 CBX3 Heterochromatin protein 1 homolog gamma Modifier 2 protein HECH protein protein human Homo sapiens Human MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ cbx5_mouse Chromobox protein homolog 5 Cbx5 Hp1a Heterochromatin protein 1 homolog alpha protein protein mouse Mus musculus Mouse MGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESAKS legas4-cbx5-3 1459212 n/a 1459217 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459218 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2d legas4-cbx5-4 1459212 n/a 1459218 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified P45973:p.Ile165Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 1459217 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f2e legas4-cbx5-5 1459212 n/a 1459218 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified P45973:p.Trp174Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 1459217 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f2e legas4-cbx5-6 1459212 n/a 1459217 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1459218 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false f2f legas4-npm1 1459213 n/a 1459217 tag visualisation tag visualisation unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1459219 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f1b sf1c npm1-q7wdl8 1459213 n/a 1459220 tag visualisation tag visualisation unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459219 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3b npm1-q7wdl8-1 1459213 n/a 1459221 tag visualisation tag visualisation unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459219 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3b cbx5-legas4 1459214 n/a 1459217 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459218 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2a legas4-cbx5 1459214 n/a 1459222 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459217 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2a legas4-cbx5-1 1459215 n/a 1459217 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459218 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2b legas4-cbx5-2 1459215 n/a 1459217 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459222 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2b cbx5-legas4-1 1459216 n/a 1459217 tag visualisation tag visualisation unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459223 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false sf3