UniProt UniProt http://www.uniprot.org zhou-2013a-1 The crystal structure of human GDP-L-fucose synthase. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhou H., Sun L., Li J., Xu C., Yu F., Liu Y., Ji C., He J. hejh@sinap.ac.cn Acta Biochim. Biophys. Sin. (Shanghai) (1672-9145) 2013 Only protein-protein interactions imex curation fcl_human GDP-L-fucose synthase GFUS GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase Protein FX Red cell NADP(H)-binding protein SDR4E1 Short-chain dehydrogenase/reductase family 4E member 1 TSTA3 protein protein human Homo sapiens Human MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK tsta3-tsta3 1458874 n/a 1458875 self self neutral component neutral component full_length sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1458875 self self neutral component neutral component full_length sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 1458881 1458878 direct interaction direct interaction false false false R-factor: 0.234, R-free: 0.291 2.37 A Fig 3