UniProt UniProt http://www.uniprot.org hirvonen-2013-3 Novel interaction of Rab13 and Rab8 with endospanins. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi FEBS Open Bio 2013 mimix curation hirvonen-2013-4 Novel interaction of Rab13 and Rab8 with endospanins. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down western blot western blot Immuno blot Immuno blot Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi FEBS Open Bio 2013 mimix curation hirvonen-2013-1 Novel interaction of Rab13 and Rab8 with endospanins. ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi FEBS Open Bio 2013 mimix curation hirvonen-2013-2 Novel interaction of Rab13 and Rab8 with endospanins. ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi FEBS Open Bio 2013 mimix curation hirvonen-2013-5 Novel interaction of Rab13 and Rab8 with endospanins. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down western blot western blot Immuno blot Immuno blot Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. Not possible to curate interaction with RAB8 since species is unknown. mirhei@utu.fi FEBS Open Bio 2013 mimix curation hirvonen-2013-6 Novel interaction of Rab13 and Rab8 with endospanins. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi FEBS Open Bio 2013 mimix curation hirvonen-2013-7 Novel interaction of Rab13 and Rab8 with endospanins. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Hirvonen M.J., Büki K.G., Sun Y., Mulari M.T., Härkönen P.L., Väänänen K.H. mirhei@utu.fi FEBS Open Bio 2013 mimix curation lerl1_rat Leptin receptor overlapping transcript-like 1 Endospanin-2 Leprotl1 protein protein rat Rattus norvegicus (Rat) Rat MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGVVVSAFGLPVVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW rab13_rat Ras-related protein Rab-13 Rab13 protein protein rat Rattus norvegicus (Rat) Rat MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVEIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQREQAERLAREHRIRFFETSAKSSVNVDEAFSSLARDILLKTGGRRSGNSSKPSSTDLKVSDKKNSNKCSLG obrg_rat Leptin receptor gene-related protein Endospanin-1 Leprot Lepr Obr OB-R gene-related protein protein protein rat Rattus norvegicus (Rat) Rat MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLVFGRGDDFSWEQW rab13_human Ras-related protein Rab-13 RAB13 GIG4 Cell growth-inhibiting gene 4 protein protein protein human Homo sapiens Human MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG leprotl1-rab13 1435934 n/a 1435941 unspecified role unspecified role bait bait n/a 1435942 unspecified role unspecified role prey prey direct interaction direct interaction false false false fig 1C leprot-rab13 1435934 n/a 1435942 unspecified role unspecified role prey prey n/a 1435943 unspecified role unspecified role bait bait direct interaction direct interaction false false false fig 1C leprotl1-rab13-2 1435935 n/a 1435941 unspecified role unspecified role bait bait n/a 1435944 unspecified role unspecified role prey prey physical association physical association false false false fig 1D leprot-rab13-1 1435935 n/a 1435944 unspecified role unspecified role prey prey n/a 1435943 unspecified role unspecified role bait bait physical association physical association false false false fig 1D rab13-leprotl1 1435936 n/a 1435941 unspecified role unspecified role prey prey n/a 1435942 unspecified role unspecified role bait bait physical association physical association false false false not shown rab13-leprotl1-1 1435937 n/a 1435941 unspecified role unspecified role prey prey n/a 1435942 unspecified role unspecified role bait bait physical association physical association false false false fig 1A leprotl1-rab13-1 1435938 n/a 1435944 unspecified role unspecified role prey prey n/a 1435941 unspecified role unspecified role bait bait physical association physical association false false false fig 1F rab13-leprotl1-2 1435939 n/a 1435941 unspecified role unspecified role prey prey n/a 1435944 unspecified role unspecified role bait bait physical association physical association false false false fig 2A leprotl1-rab13-3 1435940 n/a 1435944 unspecified role unspecified role neutral component neutral component n/a 1435941 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false fig 2C