IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ shi-2013-1 Rif1 and Rif2 shape telomere function and architecture through multivalent Rap1 interactions. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shi T., Bunker R.D., Mattarocci S., Ribeyre C., Faty M., Gut H., Scrima A., Rass U., Rubin S.M., Shore D., Thomä N.H. The PDB submission describes a longer construct for Rap1 (627-872) than is described in the paper. The constructs described in the publication have been used in this entry. nicolas.thoma@fmi.ch Cell (0092-8674) 2013 Only protein-protein interactions imex curation shi-2013-2 Rif1 and Rif2 shape telomere function and architecture through multivalent Rap1 interactions. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Shi T., Bunker R.D., Mattarocci S., Ribeyre C., Faty M., Gut H., Scrima A., Rass U., Rubin S.M., Shore D., Thomä N.H. nicolas.thoma@fmi.ch Cell (0092-8674) 2013 Only protein-protein interactions imex curation shi-2013-3 Rif1 and Rif2 shape telomere function and architecture through multivalent Rap1 interactions. in vitro In vitro electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi T., Bunker R.D., Mattarocci S., Ribeyre C., Faty M., Gut H., Scrima A., Rass U., Rubin S.M., Shore D., Thomä N.H. Crystals were dissolved in water and resolved on an 18% SDS-polyacrylamide gel. nicolas.thoma@fmi.ch Cell (0092-8674) 2013 Only protein-protein interactions imex curation shi-2013-4 Rif1 and Rif2 shape telomere function and architecture through multivalent Rap1 interactions. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shi T., Bunker R.D., Mattarocci S., Ribeyre C., Faty M., Gut H., Scrima A., Rass U., Rubin S.M., Shore D., Thomä N.H. nicolas.thoma@fmi.ch Cell (0092-8674) 2013 Only protein-protein interactions imex curation shi-2013-5 Rif1 and Rif2 shape telomere function and architecture through multivalent Rap1 interactions. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shi T., Bunker R.D., Mattarocci S., Ribeyre C., Faty M., Gut H., Scrima A., Rass U., Rubin S.M., Shore D., Thomä N.H. nicolas.thoma@fmi.ch Cell (0092-8674) 2013 Only protein-protein interactions imex curation shi-2013-6 Rif1 and Rif2 shape telomere function and architecture through multivalent Rap1 interactions. in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Shi T., Bunker R.D., Mattarocci S., Ribeyre C., Faty M., Gut H., Scrima A., Rass U., Rubin S.M., Shore D., Thomä N.H. nicolas.thoma@fmi.ch Cell (0092-8674) 2013 Only protein-protein interactions imex curation rif2_yeast Protein RIF2 RIF2 RAP1-interacting factor 2 YLR453C protein protein yeast Saccharomyces cerevisiae Baker's yeast MEHVDSDFAPIRRSKKVVDSDKIVKAISDDLEQKNFTVLRKLNLVPIKKSVSSPKVCKPSPVKERVDHVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKEGIQSSKSKECIESMGQASYSGQLDFEASEKPSNHTSDLMMMVMRKINNDESIDHIVYFKFEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKKNQRLPLKLTRKVHDR rap1_yeast DNA-binding protein RAP1 RAP1 GRF1 TUF1 YNL216W N1310 SBF-E Repressor/activator site-binding protein TUF protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSPDDFETAPAEYVDALDPSMVVVDSGSAAVTAPSDSAAEVKANQNEENTGATAAETSEKVDQTEVEKKDDDDTTEVGVTTTTPSIADTAATANIASTSGASVTEPTTDDTAADEKKEQVSGPPLSNMKFYLNRDADAHDSLNDIDQLARLIRANGGEVLDSKPRESKENVFIVSPYNHTNLPTVTPTYIKACCQSNSLLNMENYLVPYDNFREVVDSRLQEESHSNGVDNSNSNSDNKDSIRPKTEIISTNTNGATEDSTSEKVMVDAEQQARLQEQAQLLRQHVSSTASITSGGHNDLVQIEQPQKDTSNNNNSNVNDEDNDLLTQDNNPQTADEGNASFQAQRSMISRGALPSHNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLITDEDTPTAIARRNMTMDPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKRARNYSSQRNVQPTANAASANAAAAAAAAASNSYAIPENELLDEDTMNFISSLKNDLSNISNSLPFEYPHEIAEAIRSDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKDLL 67C4AFB03B3C0713 rif1_yeast Telomere length regulator protein RIF1 RIF1 RAP1-interacting factor 1 YBR1743 YBR275C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKDFSDKKKHTIDRIDQHILRRSQHDNYSNGSSPWMKTNLPPPSPQAHMHIQSDLSPTPKRRKLASSSDCENKQFDLSAINKNLYPEDTGSRLMQSLPELSASNSDNVSPVTKSVAFSDRIESSPIYRIPGSSPKPSPSSKPGKSILRNRLPSVRTVSDLSYNKLQYTQHKLHNGNIFTSPYKETRVNPRALEYWVSGEIHGLVDNESVSEFKEIIEGGLGILRQESEDYVARRFEVYATFNNIIPILTTKNVNEVDQKFNILIVNIESIIEICIPHLQIAQDTLLSSSEKKNPFVIRLYVQIVRFFSAIMSNFKIVKWLTKRPDLVNKLKVIYRWTTGALRNENSNKIIITAQVSFLRDEKFGTFFLSNEEIKPIISTFTEIMEINSHNLIYEKLLLIRGFLSKYPKLMIETVTSWLPGEVLPRIIIGDEIYSMKILITSIVVLLELLKKCLDFVDEHERIYQCIMLSPVCETIPEKFLSKLPLNSYDSANLDKVTIGHLLTQQIKNYIVVKNDNKIAMDLWLSMTGLLYDSGKRVYDLTSESNKVWFDLNNLCFINNHPKTRLMSIKVWRIITYCICTKISQKNQEGNKSLLSLLRTPFQMTLPYVNDPSAREGIIYHLLGVVYTAFTSNKNLSTDMFELFWDHLITPIYEDYVFKYDSIHLQNVLFTVLHLLIGGKNADVALERKYKKHIHPMSVIASEGVKLKDISSLPPQIIKREYDKIMKVVFQAVEVAISNVNLAHDLILTSLKHLPEDRKDQTHLESFSSLILKVTQNNKDTPIFRDFFGAVTSSFVYTFLDLFLRKNDSSLVNFNIQISKVGISQGNMTLDLLKDVIRKARNETSEFLIIEKFLELDDKKTEVYAQNWVGSTLLPPNISFREFQSLANIVNKVPNENSIENFLDLCLKLSFPVNLFTLLHVSMWSNNNFIYFIQSYVSKNENKLNVDLITLLKTSLPGNPELFSGLLPFLRRNKFMDILEYCIHSNPNLLNSIPDLNSDLLLKLLPRSRASYFAANIKLFKCSEQLTLVRWLLKGQQLEQLNQNFSEIENVLQNASDSELEKSEIIRELLHLAMANPIEPLFSGLLNFCIKNNMADHLDEFCGNMTSEVLFKISPELLLKLLTYKEKPNGKLLAAVIEKIENGDDDYILELLEKIIIQKEIQILEKLKEPLLVFFLNPVSSNMQKHKKSTNMLRELVLLYLTKPLSRSAAKKFFSMLISILPPNPNYQTIDMVNLLIDLIKSHNRKFKDKRTYNATLKTIGKWIQESGVVHQGDSSKEIEAIPDTKSMYIPCEGSENKLSNLQRKVDSQDIQVPATQGMKEPPSSIQISSQISAKDSDSISLKNTAIMNSSQQESHANRSRSIDDETLEEVDNESIREIDQQMKSTQLDKNVANHSNICSTKSDEVDVTELHESIDTQSSEVNAYQPIEVLTSELKAVTNRSIKTNPDHNVVNSDNPLKRPSKETPTSENKRSKGHETMVDVLVSEEQAVSPSSDVICTNIKSIANEESSLALRNSIKVETNCNENSLNVTLDLDQQTITKEDGKGQVEHVQRQENQESMNKINSKSFTQDNIAQYKSVKKARPNNEGENNDYACNVEQASPVRNEVPGDGIQIPSGTILLNSSKQTEKSKVDDLRSDEDEHGTVAQEKHQVGAINSRNKNNDRMDSTPIQGTEEESREVVMTEEGINVRLEDSGTCELNKNLKGPLKGDKDANINDDFVPVEENVRDEGFLKSMEHAVSKETGLEEQPEVADISVLPEIRIPIFNSLKMQGSKSQIKEKLKKRLQRNELMPPDSPPRMTENTNINAQNGLDTVPKTIGGKEKHHEIQLGQAHTEADGEPLLGGDGNEDATSREATPSLKVHFFSKKSRRLVARLRGFTPGDLNGISVEERRNLRIELLDFMMRLEYYSNRDNDMN rap1-rif2-2 1440138 n/a 1440144 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1440145 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 1440151 1440149 direct interaction direct interaction false false false 3.3A R = 0.18 Rwork = 0.18 Rfree = 0.19 Supp. Table 1 rap1-rif1 1440138 n/a 1440145 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1440146 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) 1440156 1440154 direct interaction direct interaction false false false 1.6A Rwork = 0.17 Rfree = 0.18 Supp. Table 1 rap1-rif2-6 1440138 n/a 1440144 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1440145 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1440144 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction false false false 3.3A R = 0.17 Rwork = 0.17 Rfree = 0.2 Supp. Table 1 rap1-rif1-1 1440139 n/a 1440145 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1440146 unspecified role unspecified role neutral component neutral component P29539:p.Leu1905Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 1440170 1440166 direct interaction direct interaction false false false 1440139 Fig. 2H, Supp. Fig. 3C, 3D rap1-rif2-3 1440139 n/a 1440144 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 1.0 n/a 1440145 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 1440176 1440173 1440177 1440174 direct interaction direct interaction false false false 1440139 Fig. 1G-I A Rif2 RBM construct (30–49) bound Rap1 with an affinity of 30 uM, a Rif2 construct retaining the AAA+ interface (61-371), bound Rap with an affinity of 50 uM rap1-rif2-4 1440140 n/a 1440144 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1440145 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp. Fig. 2C rap1-rif2-5 1440141 n/a 1440144 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1440145 unspecified role unspecified role bait bait region strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Supp. Fig. 2D rap1-rif1-3 1440142 n/a 1440145 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P11938:p.Ala733Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P11938:p.Gly760Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false n/a 1440146 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P29539:p.Ile1760Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P29539:p.Leu1905Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P29539:p.Arg1895Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P29539:p.Ile1762Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P29539:p.Ile1764Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false 1440196 1440192 physical association physical association false false false Fig 2E/G rif1-1 1440143 n/a 1440146 unspecified role unspecified role neutral component neutral component P29539:p.Leu1905Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false Supp. Fig. 3B