MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lindenberg-2013-1 The EAL domain protein YciR acts as a trigger enzyme in a c-di-GMP signalling cascade in E. coli biofilm control. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lindenberg S., Klauck G., Pesavento C., Klauck E., Hengge R. Rhenggea@zedat.fu-berlin.de EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation lindenberg-2013-2 The EAL domain protein YciR acts as a trigger enzyme in a c-di-GMP signalling cascade in E. coli biofilm control. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lindenberg S., Klauck G., Pesavento C., Klauck E., Hengge R. Rhenggea@zedat.fu-berlin.de EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation lindenberg-2013-3 The EAL domain protein YciR acts as a trigger enzyme in a c-di-GMP signalling cascade in E. coli biofilm control. in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Lindenberg S., Klauck G., Pesavento C., Klauck E., Hengge R. Rhenggea@zedat.fu-berlin.de EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation pder_ecoli Cyclic di-GMP phosphodiesterase PdeR pdeR gmr yciR JW1278 b1285 protein protein ecoli Escherichia coli (strain K12) MKTVRESTTLYNFLGSHNPYWRLTESSDVLRFSTTETTEPDRTLQLSAEQAARIREMTVITSSLMMSLTVDESDLSVHLVGRKINKREWAGNASAWHDTPAVARDLSHGLSFAEQVVSEAHSAIVILDSRGNIQRFNRLCEDYTGLKEHDVIGQSVFKLFMSRREAAASRRNNRVFFRSGNAYEVELWIPTCKGQRLFLFRNKFVHSGSGKNEIFLICSGTDITEERRAQERLRILANTDSITGLPNRNAMQDLIDHAINHADNNKVGVVYLDLDNFKKVNDAYGHLFGDQLLRDVSLAILSCLEHDQVLARPGGDEFLVLASNTSQSALEAMASRILTRLRLPFRIGLIEVYTSCSVGIALSPEHGSDSTAIIRHADTAMYTAKEGGRGQFCVFTPEMNQRVFEYLWLDTNLRKALENDQLVIHYQPKITWRGEVRSLEALVRWQSPERGLIPPLDFISYAEESGLIVPLGRWVILDVVRQVAKWRDKGINLRVAVNISARQLADQTIFTALKQVLQELNFEYCPIDVELTESCLIENDELALSVIQQFSQLGAQVHLDDFGTGYSSLSQLARFPIDAIKLDQVFVRDIHKQPVSQSLVRAIVAVAQALNLQVIAEGVESAKEDAFLTKNGINERQGFLFAKPMPAVAFERWYKRYLKRA dgcm_ecoli Diguanylate cyclase DgcM dgcM ydaM JW5206 b1341 protein protein ecoli Escherichia coli (strain K12) MITHNFNTLDLLTSPVWIVSPFEEQLIYANSAAKLLMQDLTFSQLRTGPYSVSSQKELPKYLSDLQNQHDIIEILTVQRKEEETALSCRLVLRKLTETEPVIIFEGIEAPATLGLKASRSANYQRKKQGFYARFFLTNSAPMLLIDPSRDGQIVDANLAALNFYGYNHETMCQKHTWEINMLGRRVMPIMHEISHLPGGHKPLNFVHKLADGSTRHVQTYAGPIEIYGDKLMLCIVHDITEQKRLEEQLEHAAHHDAMTGLLNRRQFYHITEPGQMQHLAIAQDYSLLLIDTDRFKHINDLYGHSKGDEVLCALARTLESCARKGDLVFRWGGEEFVLLLPRTPLDTALSLAETIRVSVAKVSISGLPRFTVSIGVAHHEGNESIDELFKRVDDALYRAKNDGRNRVLAA mlra_ecoli HTH-type transcriptional regulator MlrA yehV MerR-like regulator A mlrA b2127 JW2115 protein protein ecoli Escherichia coli (strain K12) MALYTIGEVALLCDINPVTLRAWQRRYGLLKPQRTDGGHRLFNDADIDRIREIKRWIDNGVQVSKVKMLLSNENVDVQNGWRDQQETLLTYLQSGNLHSLRTWIKERGQDYPAQTLTTHLFIPLRRRLQCQQPTLQALLAILDGVLINYIAICLASARKKQGKDALVVGWNIQDTTRLWLEGWIASQQGWRIDVLAHSLNQLRPELFEGRTLLVWCGENRTSAQQQQLTSWQEQGHDIFPLGI gmr-ydam-1 1448793 n/a 1448796 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1448797 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a gmr-ydam-2 1448793 n/a 1448797 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain certain certain sequence position certain false n/a 1448796 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a gmr-ydam-3 1448793 n/a 1448796 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448797 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain certain certain sequence position certain false tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a gmr-ydam-4 1448793 n/a 1448797 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain certain certain sequence position certain false tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448796 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a gmr-mlra 1448793 n/a 1448798 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448796 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3a Full‐size YdaM did hardly show any indication of interacting with MlrA, nor with the two isolated MlrA domains. However, the isolated YdaM domains showed some interaction with full‐size MlrA. Strikingly, the YdaM‐GGDEF domain alone exhibited strong interaction with MlrA‐CTD, that is, the c‐di‐GMP producing domain of YdaM can make a direct contact with the putative ligand‐binding domain of MlrA. This interaction of MlrA‐CTD was clearly not observed with the full‐size YdaM protein, which means that the presence of the YdaM‐NTD can inhibit a therefore conditional interaction between the YdaM‐GGDEF domain and MlrA‐CTD. Moreover, this interaction was specific, because MlrA‐CTD did not interact with the GGDEF domains of YciR, YegE or YaiC (Figure 3A, lower right panel). gmr-mlra-1 1448793 n/a 1448797 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1448798 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a Full‐size YdaM did hardly show any indication of interacting with MlrA, nor with the two isolated MlrA domains. However, the isolated YdaM domains showed some interaction with full‐size MlrA. Strikingly, the YdaM‐GGDEF domain alone exhibited strong interaction with MlrA‐CTD, that is, the c‐di‐GMP producing domain of YdaM can make a direct contact with the putative ligand‐binding domain of MlrA. This interaction of MlrA‐CTD was clearly not observed with the full‐size YdaM protein, which means that the presence of the YdaM‐NTD can inhibit a therefore conditional interaction between the YdaM‐GGDEF domain and MlrA‐CTD. Moreover, this interaction was specific, because MlrA‐CTD did not interact with the GGDEF domains of YciR, YegE or YaiC (Figure 3A, lower right panel). ydam-mlra 1448793 n/a 1448797 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448797 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3 Full‐size YdaM did hardly show any indication of interacting with MlrA, nor with the two isolated MlrA domains. However, the isolated YdaM domains showed some interaction with full‐size MlrA. Strikingly, the YdaM‐GGDEF domain alone exhibited strong interaction with MlrA‐CTD, that is, the c‐di‐GMP producing domain of YdaM can make a direct contact with the putative ligand‐binding domain of MlrA. This interaction of MlrA‐CTD was clearly not observed with the full‐size YdaM protein, which means that the presence of the YdaM‐NTD can inhibit a therefore conditional interaction between the YdaM‐GGDEF domain and MlrA‐CTD. Moreover, this interaction was specific, because MlrA‐CTD did not interact with the GGDEF domains of YciR, YegE or YaiC (Figure 3A, lower right panel). gmr-ydam-5 1448794 n/a 1448796 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448797 predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified s tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2 mlra-gmr-1 1448794 n/a 1448796 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448798 predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified s tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2 mlra-gmr 1448794 n/a 1448797 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448798 predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified s tag s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2 ydam-1 1448795 n/a 1448797 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 4.0 direct interaction direct interaction false false false sf4 ydam-1 1448795 n/a 1448797 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false sf4b