MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kappei-2013-4 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kappei D., Butter F., Benda C., Scheibe M., Draškovič I., Stevense M., Novo C.L., Basquin C., Araki M., Araki K., Krastev D.B., Kittler R., Jessberger R., Londoño-Vallejo J.A., Mann M., Buchholz F. mmann@biochem.mpg.de EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation kappei-2013-5 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kappei D., Butter F., Benda C., Scheibe M., Draškovič I., Stevense M., Novo C.L., Basquin C., Araki M., Araki K., Krastev D.B., Kittler R., Jessberger R., Londoño-Vallejo J.A., Mann M., Buchholz F. mmann@biochem.mpg.de EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation kappei-2013-1 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Kappei D., Butter F., Benda C., Scheibe M., Draškovič I., Stevense M., Novo C.L., Basquin C., Araki M., Araki K., Krastev D.B., Kittler R., Jessberger R., Londoño-Vallejo J.A., Mann M., Buchholz F. mmann@biochem.mpg.de EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation kappei-2013-2 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kappei D., Butter F., Benda C., Scheibe M., Draškovič I., Stevense M., Novo C.L., Basquin C., Araki M., Araki K., Krastev D.B., Kittler R., Jessberger R., Londoño-Vallejo J.A., Mann M., Buchholz F. mmann@biochem.mpg.de EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation kappei-2013-3 HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Kappei D., Butter F., Benda C., Scheibe M., Draškovič I., Stevense M., Novo C.L., Basquin C., Araki M., Araki K., Krastev D.B., Kittler R., Jessberger R., Londoño-Vallejo J.A., Mann M., Buchholz F. mmann@biochem.mpg.de EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation hmbx1_mouse Homeobox-containing protein 1 Hmbox1 protein protein mouse Mus musculus Mouse MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGSSYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPLPCTTNQNGRENNDRLSTSNGKMSPSRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQGSDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATPGTFRLRRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD Putative transcription factor mint terf1_mouse Telomeric repeat-binding factor 1 Terf1 Trf1 TTAGGG repeat-binding factor 1 protein protein mouse Mus musculus Mouse MAETVSSAARDAPSREGWTDSDSPEQEEVGDDAELLQCQLQLGTPREMENAELVAEVEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRDSAEAIIHGLHRLTAYQLKTVYICQFLTRVASGKALDAQFEVDERITPLESALMIWNSIEKEHDKLHDEIKNLIKIQAVAVCMEIGSFKEAEEVFERIFGDPEFYTPLERKLLKIISQKDVFHSLFQHFSYSCMMEKIQSYVGDVLSEKSSTFLMKAATKVVENEKARTQASKDRPDATNTGMDTEVGLNKEKSVNGQQSTETEPLVDTVSSIRSHKNALSQLKHRRAPSDFSRNEARTGTLQCETTMERNRRTSGRNRLCVSENQPDTDDKSGRRKRQTWLWEEDRILKCGVKKYGEGNWAKILSHYKFNNRTSVMLKDRWRTMKRLKLIS sycp3_mouse Synaptonemal complex protein 3 Sycp3 Scp3 protein protein mouse Mus musculus Mouse MLRGCGDSDSSPEPLSKHLKMVPGGRKHSGKSGKPPLVDQPKKAFDFEKDDKDLSGSEEDVADEKAPVIDKHGKKRSAGIIEDVGGEVQNMLEKFGADINKALLAKRKRIEMYTKASFKASNQKIEQIWKTQQEEIQKLNNEYSQQFMNVLQQWELDIQKFEEQGEKLSNLFRQQQKIFQQSRIVQSQRMFAMKQIHEQFIKSLEDVEKNNDNLFTGTQSELKKEMAMLQKKVMMETQQQEMANVRKSLQSMLF tfr2_mouse Transferrin receptor protein 2 Tfr2 Trfr2 protein protein mouse Mus musculus Mouse MEQRWGLLRRVQQWSPRPSQTIYRRVEGPQLEHLEEEDREEGAELPAQFCPMELKGPEHLGSCPGRSIPIPWAAAGRKAAPYLVLITLLIFTGAFLLGYVAFRGSCQACGDSVLVVDEDVNPEDSGRTTLYWSDLQAMFLRFLGEGRMEDTIRLTSLRERVAGSARMATLVQDILDKLSRQKLDHVWTDTHYVGLQFPDPAHANTLHWVDADGSVQEQLPLEDPEVYCPYSATGNATGKLVYAHYGRSEDLQDLKAKGVELAGSLLLVRVGITSFAQKVAVAQDFGAQGVLIYPDPSDFSQDPHKPGLSSHQAVYGHVHLGTGDPYTPGFPSFNQTQFPPVESSGLPSIPAQPISADIADQLLRKLTGPVAPQEWKGHLSGSPYRLGPGPDLRLVVNNHRVSTPISNIFACIEGFAEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSNGFRPRRSLLFISWDGGDFGSVGATEWLEGYLSVLHLKAVVYVSLDNSVLGDGKFHAKTSPLLVSLIENILKQVDSPNHSGQTLYEQVALTHPSWDAEVIQPLPMDSSAYSFTAFAGVPAVEFSFMEDDRVYPFLHTKEDTYENLHKMLRGRLPAVVQAVAQLAGQLLIRLSHDHLLPLDFGRYGDVVLRHIGNLNEFSGDLKERGLTLQWVYSARGDYIRAAEKLRKEIYSSERNDERLMRMYNVRIMRVEFYFLSQYVSPADSPFRHIFLGQGDHTLGALVDHLRMLRADGSGAASSRLTAGLGFQESRFRRQLALLTWTLQGAANALSGDVWNIDNNF mint Mediates cellular uptake of transferrin-bound iron in a non-iron dependent manner. May be involved in iron metabolism, hepatocyte function and erythrocyte differentiation hmbx1_human Homeobox-containing protein 1 HMBOX1 HOT1 Homeobox telomere-binding protein 1 TAH1 Telomere-associated homeobox-containing protein 1 protein protein human Homo sapiens Human MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGSSYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQGSDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD dkc1_human H/ACA ribonucleoprotein complex subunit DKC1 Dyskerin Nucleolar protein family A member 4 snoRNP protein DKC1 Nopp140-associated protein of 57 kDa Nucleolar protein NAP57 CBF5 homolog DKC1 NOLA4 protein protein human Homo sapiens Human MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKRESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE coil_mouse Coilin p80-coilin Coil CLN80 protein protein mouse Mus musculus Mouse MAASETVRLRLQFDYPPPATPHCTVFWLLVDLNRCRVVTDLISLIRQRFGFSSGALLGLYLEGGLLPPAESARLVRDNDSLRVKLEDQGLPENLIVSNGGDSSFPCRKAKKRAFKLMEDEETDQGYKSLKKHCKRQEDSGQNEKASDLETKLLPDETGRTKSKKKSKVTGSPAEEDEEETKKKSSKRKEKCEPKKQTRASKSSKQQTPKEGASQNCSFPRASPRSLGKARRRSSTGLKGSSGHLSESESCPESVSDGHCSVMMQEVTFSEKLSAELLKDAPATKTAAANRQASKPGFTFSSGKGKASRTSSSSSDSSSESEDQFLVSKNMLEGASAGFLKPTGLFAGQGGSGPGLSLETPGIMGWKSSDSNRGRQAPGPPSTPVPTSLGRGWGRGEDLLFGKGLRGRGVRGRGRGRGQAVSCVFNRSSESQKQRQLNDILTNSSVVIQNPVEPPKKDYSLLPLLAAAPQVGEKIAFKLLELTSDYSPDVSDYKEGKILSHDPETQQVDIEVLSSLPALKEPGKFDLVYHNENGTEVVEYAVTQEKRITVLWRELIDPRLIIDSSGSISST mint xrcc6_human X-ray repair cross-complementing protein 6 XRCC6 G22P1 ATP-dependent DNA helicase II 70 kDa subunit Lupus Ku autoantigen protein p70 70 kDa subunit of Ku antigen Thyroid-lupus autoantigen CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 ATP-dependent DNA helicase 2 subunit 1 5'-deoxyribose-5-phosphate lyase Ku70 protein protein human Homo sapiens Human MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD coil_human Coilin COIL CLN80 p80-coilin protein protein human Homo sapiens Human MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA xrcc5_human X-ray repair cross-complementing protein 5 XRCC5 G22P2 ATP-dependent DNA helicase II 80 kDa subunit Lupus Ku autoantigen protein p86 86 kDa subunit of Ku antigen Ku86 Ku80 Thyroid-lupus autoantigen CTC box-binding factor 85 kDa subunit Nuclear factor IV DNA repair protein XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) ATP-dependent DNA helicase 2 subunit 2 protein protein human Homo sapiens Human MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI nop10_human H/ACA ribonucleoprotein complex subunit 3 NOLA3 NOP10 Nucleolar protein family A member 3 snoRNP protein NOP10 Nucleolar protein 10 protein protein human Homo sapiens Human MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL nhp2_human H/ACA ribonucleoprotein complex subunit 2 Nucleolar protein family A member 2 snoRNP protein NHP2 NHP2 NOLA2 HSPC286 protein protein human Homo sapiens Human MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL gar1_human H/ACA ribonucleoprotein complex subunit 1 GAR1 NOLA1 snoRNP protein GAR1 Nucleolar protein family A member 1 protein protein human Homo sapiens Human MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH dkc1_mouse H/ACA ribonucleoprotein complex subunit DKC1 Dkc1 Dyskerin Nucleolar protein family A member 4 snoRNP protein DKC1 Nopp140-associated protein of 57 kDa Nucleolar protein NAP57 protein protein mouse Mus musculus Mouse MADAEVITFPKKHKKKKDRKPLQEDDVAEIQHAEEFLIKPESKVAQLDTSQWPLLLKNFDKLNVRTAHYTPLPCGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGLLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKMMIKQGLLDKHGKPTDNTPATWKQDYIDYSDSGKNTLVTEAVQAPQLAAEAVNVIKRKRDSESESDETPTVPQLKEKKKKKDKKPKTVLESGGETGDGDNDTTKKKKKKKVKVVEEMSE mint homomint Required for ribosome biogenesis and telomere maintenance. Probable catalytic subunit of H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ('psi') residues, which may serve to stabilize the conformation of rRNAs. Also required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme nhp2_mouse H/ACA ribonucleoprotein complex subunit 2 Nhp2 Nola2 snoRNP protein NHP2 Nucleolar protein family A member 2 protein protein mouse Mus musculus Mouse MTKVKAAPEESEAQAEGCSEERTYKELLVNLNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVLCEDQNLPYVYIPSKTDLGAATGSKRPTCVIMVKPHEEYQETYDKCLEEVQALPTPL Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme mint nop10_mouse H/ACA ribonucleoprotein complex subunit 3 Nop10 Nola3 snoRNP protein NOP10 Nucleolar protein 10 Nucleolar protein family A member 3 protein protein mouse Mus musculus Mouse MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme mint xrcc5_mouse X-ray repair cross-complementing protein 5 Xrcc5 G22p2 ATP-dependent DNA helicase 2 subunit 2 ATP-dependent DNA helicase II 80 kDa subunit Ku autoantigen protein p86 homolog Ku80 CTC box-binding factor 85 kDa subunit Nuclear factor IV DNA repair protein XRCC5 protein protein mouse Mus musculus Mouse MAWSGNKAAVVLCVDVGVAMGNSFPGEESPIEQAKKVMTMFVQRQVFSESKDEIALVLYGTDGTDNALAGKDQYQNITVCRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQRETIGKKFGKKHIEVFTDLSSPFSQDQLDVIICNLKKSGISLQFFLPFPIDKNGEPGERGDLDSGLDHLKPSFPQKGLTEQQKEGIRMVTRVMLSLEGEDGLDEIYSFSESLRQLCVFKKIERRSMPWPCQLTIGPNLSIKIVAYKSIVQEKFKKSWVVVDARTLKKEDIQKETVYCLNDDDETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHRRFFMGHQVLKVFAAKDDEAAAVALSSLVHALDELNMVAIVRYAYDKRSNPQVGVAFPYIKDAYECLVYVQLPFMEDLRQYMFSSLKNNKKCTPTEAQLSAIDDLIDSMSLVKKNEEEDIVEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCESPLSKVKTLFPLTEVIKKKNQVTAQDVFQDNHEEGPAAKKYKTEKEEDHISISSLAEGNITKVGSVNPVENFRFLVRQKIASFEEASLQLISHIEQFLDTNETLYFMKSMDCIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSITAEEATKFLAPKDKAKEDTTGPEEAGDVDDLLDMI xrcc6_mouse X-ray repair cross-complementing protein 6 ATP-dependent DNA helicase II 70 kDa subunit Ku autoantigen protein p70 homolog CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 Xrcc6 G22p1 Ku70 5'-deoxyribose-5-phosphate lyase Ku70 ATP-dependent DNA helicase 2 subunit 1 protein protein mouse Mus musculus Mouse MSEWESYYKTEGEEEEEEEESPDTGGEYKYSGRDSLIFLVDASRAMFESQGEDELTPFDMSIQCIQSVYTSKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQDLDNPGAKRVLELDQFKGQQGKKHFRDTVGHGSDYSLSEVLWVCANLFSDVQLKMSHKRIMLFTNEDDPHGRDSAKASRARTKASDLRDTGIFLDLMHLKKPGGFDVSVFYRDIITTAEDEDLGVHFEESSKLEDLLRKVRAKETKKRVLSRLKFKLGEDVVLMVGIYNLVQKANKPFPVRLYRETNEPVKTKTRTFNVNTGSLLLPSDTKRSLTYGTRQIVLEKEETEELKRFDEPGLILMGFKPTVMLKKQHYLRPSLFVYPEESLVSGSSTLFSALLTKCVEKKVIAVCRYTPRKNVSPYFVALVPQEEELDDQNIQVTPGGFQLVFLPYADDKRKVPFTEKVTANQEQIDKMKAIVQKLRFTYRSDSFENPVLQQHFRNLEALALDMMESEQVVDLTLPKVEAIKKRLGSLADEFKELVYPPGYNPEGKVAKRKQDDEGSTSKKPKVELSEEELKAHFRKGTLGKLTVPTLKDICKAHGLKSGPKKQELLDALIRHLEKN gar1_mouse H/ACA ribonucleoprotein complex subunit 1 Nola1 Nucleolar protein family A member 1 snoRNP protein GAR1 Gar1 protein protein mouse Mus musculus Mouse MSFRGGGRGGFNRGGGGGGFNRGGGSNNHFRGGGGGGGGSFRGGGGGGGGSFRGGGRGGFGRGGGRGGFNKFQDQGPPERVVLLGEFMHPCEDDIVCKCTTEENKVPYFNAPVYLENKEQVGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGFRGGRGGGGFRGRGH hmbox1-terf1 1448219 n/a 1448224 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell n/a 1448225 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f4b hmbox1-terf1-1 1448219 n/a 1448224 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell n/a 1448226 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell colocalization colocalization false false false f4c sycp3-tfr2 1448219 n/a 1448227 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell n/a 1448226 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell colocalization colocalization false false false f4c hmbox1-terf1-2 1448219 n/a 1448228 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell Q6NT76:p.Arg339Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1448225 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false sf4b hmbox1-dkc1 1448220 n/a 1448229 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448228 predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physical association physical association false false false f5b hmbox1-dkc1-1 1448220 n/a 1448230 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448228 predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physical association physical association false false false f5b hmbox1-coil-1 1448220 n/a 1448228 predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep n/a 1448231 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physical association physical association false false false f5b coil-dkc1 1448221 n/a 1448232 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448233 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448231 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448234 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448235 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448236 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448229 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448228 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep association association false false false f5a sf6a coil-hmbox1 1448222 n/a 1448232 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell n/a 1448228 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell colocalization colocalization false false false f5e hmbox1-coil 1448223 n/a 1448237 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448224 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep n/a 1448238 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448239 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448230 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448240 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448241 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep n/a 1448242 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep association association false false false sf6b