IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2013f-3 Ferritin light chain interacts with PEN-2 and affects γ-secretase activity. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Li X., Liu Y., Zheng Q., Yao G., Cheng P., Bu G., Xu H., Zhang Y.W. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. yunzhang@xmu.edu.cn human fetal cDNA library Neurosci. Lett. (0304-3940) 2013 Only protein-protein interactions imex curation Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease li-2013f-1 Ferritin light chain interacts with PEN-2 and affects γ-secretase activity. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li X., Liu Y., Zheng Q., Yao G., Cheng P., Bu G., Xu H., Zhang Y.W. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. yunzhang@xmu.edu.cn human fetal cDNA library Neurosci. Lett. (0304-3940) 2013 Only protein-protein interactions imex curation Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease li-2013f-2 Ferritin light chain interacts with PEN-2 and affects γ-secretase activity. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li X., Liu Y., Zheng Q., Yao G., Cheng P., Bu G., Xu H., Zhang Y.W. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. yunzhang@xmu.edu.cn human fetal cDNA library Neurosci. Lett. (0304-3940) 2013 Only protein-protein interactions imex curation Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease pen2_human Gamma-secretase subunit PEN-2 Presenilin enhancer protein 2 PSENEN PEN2 MDS033 protein protein human Homo sapiens Human MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP fril_human Ferritin light chain FTL protein protein human Homo sapiens Human MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD psenen-ftl-2 1454870 n/a 1454873 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1454874 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1B ftl-psenen 1454870 n/a 1454873 unspecified role unspecified role prey prey n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1454874 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1Bi psenen-ftl 1454871 n/a 1454874 unspecified role unspecified role prey prey n/a 1454873 unspecified role unspecified role bait bait intracellular_loop_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false no figure psenen-ftl-1 1454872 n/a 1454873 unspecified role unspecified role bait bait intracellular_loop_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1454874 unspecified role unspecified role prey prey physical association physical association false false false 1A