MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint tanegashima-2013-1 CXCL14 is a natural inhibitor of the CXCL12-CXCR4 signaling axis. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip experimental particp experimental participant identification experimental particp Tanegashima K., Suzuki K., Nakayama Y., Tsuji K., Shigenaga A., Otaka A., Hara T. FEBS Lett. (0014-5793) 2013 cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS cxl14_human C-X-C motif chemokine 14 MIP2G NJAC SCYB14 Chemokine BRAK MIP-2G Small-inducible cytokine B14 UNQ240/PRO273 PSEC0212 CXCL14 protein protein human Homo sapiens Human MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE cxcr4-cxcl14 1385358 n/a CXCR4 1385359 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait partially purified partially purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a CXCL14 1385360 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey purified purified physical association physical association false false false homomint mint f2b f2c