MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint maize-2013-1 Structural characterization of human histidine triad nucleotide-binding protein 2, a member of the histidine triad superfamily. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Maize KM., Wagner CR., Finzel BC. FEBS J. (1742-464X) 2013 hint2_human Adenosine 5'-monophosphoramidase HINT2 HINT2 HINT-3 HIT-17kDa PKCI-1-related HIT protein Histidine triad nucleotide-binding protein 2, mitochondrial protein protein human Homo sapiens Human MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG Probable hydrolase mint hint2 1386227 n/a hHint2 1386228 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false mint t2 f1 sf1