MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lu-2013b-2 ING4 inhibits the translation of proto-oncogene MYC by interacting with AUF1. in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Lu M., Pan C., Zhang L., Ding C., Chen F., Wang Q., Wang K., Zhang X. FEBS Lett. (0014-5793) 2013 lu-2013b-1 ING4 inhibits the translation of proto-oncogene MYC by interacting with AUF1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip experimental particp experimental participant identification experimental particp Lu M., Pan C., Zhang L., Ding C., Chen F., Wang Q., Wang K., Zhang X. FEBS Lett. (0014-5793) 2013 lu-2013b-4 ING4 inhibits the translation of proto-oncogene MYC by interacting with AUF1. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip experimental particp experimental participant identification experimental particp Lu M., Pan C., Zhang L., Ding C., Chen F., Wang Q., Wang K., Zhang X. FEBS Lett. (0014-5793) 2013 lu-2013b-3 ING4 inhibits the translation of proto-oncogene MYC by interacting with AUF1. human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Lu M., Pan C., Zhang L., Ding C., Chen F., Wang Q., Wang K., Zhang X. FEBS Lett. (0014-5793) 2013 lu-2013b-5 ING4 inhibits the translation of proto-oncogene MYC by interacting with AUF1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Lu M., Pan C., Zhang L., Ding C., Chen F., Wang Q., Wang K., Zhang X. FEBS Lett. (0014-5793) 2013 ing4_human Inhibitor of growth protein 4 ING4 p29ING4 My036 protein protein human Homo sapiens Human MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK q14103-2 Heterogeneous nuclear ribonucleoprotein D0 p42 Dx4 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY q14103-3 Heterogeneous nuclear ribonucleoprotein D0 p40 Dx7 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY Contains a omega-N-methylarginine at position 282. Contains a N6-acetyllysine at position 292. q14103-4 Heterogeneous nuclear ribonucleoprotein D0 p37 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY Contains a omega-N-methylarginine at position 263. Contains a N6-acetyllysine at position 273. q14103-1 Heterogeneous nuclear ribonucleoprotein D0 p45 Dx9 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY hnrpd_human Heterogeneous nuclear ribonucleoprotein D0 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY ing4-hnrnpd-1 1382787 ing4_human ING4 1382792 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q14103-2 AUF1 p42 1382793 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1c homomint mint ing4-hnrnpd-2 1382787 ing4_human ING4 1382792 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q14103-3 AUF1 p40 1382794 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1c homomint mint ing4-hnrnpd-3 1382787 ing4_human ING4 1382792 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q14103-4 AUF1 p37 1382795 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1c homomint mint ing4-hnrnpd-4 1382787 q14103-1 AUF1 p45 1382796 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ing4_human ING4 1382792 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1c homomint mint hnrnpd-ing4-2 1382787 q14103-4 AUF1 p37 1382795 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ing4_human ING4 1382792 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1d homomint mint ing4-hnrnpd-5 1382787 n/a AUF1 1382797 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a ING4 1382792 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false homomint mint f5a f5b sf6 hnrnpd-ing4 1382788 ing4_human ING4 1382792 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level hnrpd_human AUF1 1382797 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f1a homomint mint hnrnpd-ing4-1 1382788 ing4_human ING4 1382792 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level hnrpd_human AUF1 1382797 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f1a homomint mint ing4-hnrnpd 1382788 hnrpd_human AUF1 1382797 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ing4_human ING4 1382792 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1b homomint mint ing4-hnrnpd-7 1382789 ing4_human ING4 1382792 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level hnrpd_human AUF1 1382797 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false sf1a homomint mint ing4-hnrnpd-8 1382789 hnrpd_human AUF1 1382797 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ing4_human ING4 1382792 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false sf1b homomint mint hnrnpd-ing4-3 1382789 ing4_human ING4 1382792 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level hnrpd_human AUF1 1382797 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false sf1b homomint mint ing4-hnrnpd-6 1382790 ing4_human ING4 1382792 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hnrpd_human AUF1 1382797 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f5c homomint mint ing4-hnrnpd-9 1382791 hnrpd_human AUF1 1382797 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ing4_human ING4 1382792 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false sf2 homomint mint