IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kanaujiya-2013-1 Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in Proteomics (1615-9853) 2013 Only protein-protein interactions imex curation kanaujiya-2013-2 Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in Proteomics (1615-9853) 2013 Only protein-protein interactions imex curation kanaujiya-2013-3 Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in Proteomics (1615-9853) 2013 Only protein-protein interactions imex curation kanaujiya-2013-4 Proteomic identification of Profilin1 as a corepressor of estrogen receptor alpha in MCF7 breast cancer cells. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Kanaujiya J.K., Lochab S., Kapoor I., Pal P., Datta D., Bhatt M.L., Sanyal S., Behre G., Trivedi A.K. GFP was detected by tag fluorescence. Origin of PFN1 constructs derived from PMID:14691948 (found through PMID:21115820, ref. 40). Origin of ER-alpha constructs found in PMID:19598169 (through PMID:22589186. ref. 39 in the paper). Additional details about profilin and ER-alpha constructs were given by the authors upon email request. arun3vedi@cdri.res.in Proteomics (1615-9853) 2013 Only protein-protein interactions imex curation cbr1_human Carbonyl reductase [NADPH] 1 SDR21C1 Short chain dehydrogenase/reductase family 21C member 1 CBR1 CBR CRN NADPH-dependent carbonyl reductase 1 Prostaglandin-E(2) 9-reductase Prostaglandin 9-ketoreductase 15-hydroxyprostaglandin dehydrogenase [NADP(+)] 20-beta-hydroxysteroid dehydrogenase protein protein human Homo sapiens Human MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW prof1_human Profilin-1 Profilin I PFN1 Epididymis tissue protein Li 184a protein protein human Homo sapiens Human MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV prof1_mouse Profilin-1 Profilin I Pfn1 protein protein mouse Mus musculus Mouse MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY esr1-cbr1 1430693 n/a 1430697 unspecified role unspecified role prey prey cell lysate cell lysate human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells n/a 1430698 unspecified role unspecified role prey prey cell lysate cell lysate human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells n/a 1430699 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ligand binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) association association false false false 1b and supplementary table 1 pfn1-esr1 1430694 n/a 1430700 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1430699 unspecified role unspecified role prey prey cell lysate cell lysate human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells physical association physical association false false false 4Aii Tamoxifen. pfn1-esr1-1 1430695 n/a 1430699 unspecified role unspecified role prey prey n/a 1430700 unspecified role unspecified role bait bait n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 4Bi Tamoxifen. esr1-pfn1 1430696 n/a 1430700 unspecified role unspecified role neutral component neutral component n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1430699 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4C Tamoxifen and E2.