MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint rahmanpour-2013-1 Assembly in vitro of Rhodococcus jostii RHA1 encapsulin and peroxidase DypB to form a nanocompartment. in vitro In vitro bn-page blue native page bn-page experimental particp experimental participant identification experimental particp Rahmanpour R., Bugg TD. FEBS J. (1742-464X) 2013 rahmanpour-2013-2 Assembly in vitro of Rhodococcus jostii RHA1 encapsulin and peroxidase DypB to form a nanocompartment. in vitro In vitro dls dynamic light scattering dls experimental particp experimental participant identification experimental particp Rahmanpour R., Bugg TD. FEBS J. (1742-464X) 2013 q0se23_rhojr RHA1_ro02408 protein protein rhosr Rhodococcus sp. (strain RHA1) MSDSSNLHRNLAPVTEVAWQQIGEEAARTFKRHVAGRRVVDVAGPFGYSYSAHNLGRVTPIKTSDSRIRAQQRQVNPLVELRFPFTLSRAEVDDVARGSLDSDWQPVKDAAKAVAFAEDQSIFQGFDEAGIRGLGPSSDNPVLSLPEDPLLIPDAVASALSALRLAGVEGPYSVVLDADAYTAVSETRDEGHPVFHHLRDLVAGDIIWAPAISGGYVLSTRGGDNQLTLGTDLSIGYDSHTATDVTLYLEETFTFASLTAEAAVVLAR mint q0se23 1372415 encapsulin encapsulin 1372417 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f3a mint q0se23-q0se23 1372416 encapsulin encapsulin 1372417 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified encapsulin encapsulin 1372417 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3b mint