MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint schepetilnikov-2013- TOR and S6K1 promote translation reinitiation of uORF-containing mRNAs via phosphorylation of eIF3h. arath-cell-culture Arabidopsis thaliana cell culture plant_cell_culture plant cellular culture The culture conditions should always be cited in the experimental modifications annotation Either whole plant or undifferentiated plant cells maintained in culture. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schepetilnikov M., Dimitrova M., Mancera-Martínez E., Geldreich A., Keller M., Ryabova L.A. lyuba.ryabova@ibmp-cnrs.unistra.fr EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation schepetilnikov-2013- TOR and S6K1 promote translation reinitiation of uORF-containing mRNAs via phosphorylation of eIF3h. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schepetilnikov M., Dimitrova M., Mancera-Martínez E., Geldreich A., Keller M., Ryabova L.A. lyuba.ryabova@ibmp-cnrs.unistra.fr EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation kpk1_arath Serine/threonine-protein kinase AtPK1/AtPK6 Ribosomal-protein S6 kinase homolog 1 S6K1 F17O14.20 At3g08730 ATPK1 ATPK6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVSSQRPVPNKIQKQQYLSISPSNSVLKDDVELEFSDVFGPLPEEANDIAYDEPAVVYSRSHSLVGPCSLDSHSLKLTKLTLLETEDSIDLVECLEGESLKENDDFSGNDDSDNEKALEGDLVKVSGVVGIDDFEVMKVVGKGAFGKVYQVRKKETSEIYAMKVMRKDHIMEKNHAEYMKAERDILTKIDHPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAEIVSAVSHLHEKGIMHRDLKPENILMDTDGHVMLTDFGLAKEFEENTRSNSMCGTTEYMAPEIVRGKGHDKAADWWSVGILLYEMLTGKPPFLGSKGKIQQKIVKDKIKLPQFLSNEAHAILKGLLQKEPERRLGSGLSGAEEIKQHKWFKGINWKKLEAREVMPSFKPEVSGRQCIANFDKCWTDMSVLDSPASSPSSDPKANPFTNFTYVRPPPSFLHQSTTTL mint eif3c_arath Eukaryotic translation initiation factor 3 subunit C TIF3C1 F18O21_110 At3g56150 eIF3 p110 p105 Eukaryotic translation initiation factor 3 subunit 8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSRFFTQVGSESEDESDYEVEVNEVQNDDVNNRYLQSGSEDDDDTDTKRVVKPAKDKRFEEMTYTVDQMKNAMKINDWVSLQENFDKVNKQLEKVMRITEAVKPPTLYIKTLVMLEDFLNEALANKEAKKKMSTSNSKALNSMKQKLKKNNKLYEDDINKYREAPEVEEEKQPEDDDDDDDDDDEVEDDDDSSIDGPTVDPGSDVDEPTDNLTWEKMLSKKDKLLEKLMNKDPKEITWDWVNKKFKEIVAARGKKGTARFELVDQLTHLTKIAKTPAQKLEILFSVISAQFDVNPGLSGHMPINVWKKCVLNMLTILDILVKYSNIVVDDTVEPDENETSKPTDYDGKIRVWGNLVAFLERVDTEFFKSLQCIDPHTREYVERLRDEPMFLALAQNIQDYFERMGDFKAAAKVALRRVEAIYYKPQEVYDAMRKLAELVEEEEETEEAKEESGPPTSFIVVPEVVPRKPTFPESSRAMMDILVSLIYRNGDERTKARAMLCDINHHALMDNFVTARDLLLMSHLQDNIQHMDISTQILFNRTMAQLGLCAFRAGMITESHSCLSELYSGQRVRELLAQGVSQSRYHEKTPEQERMERRRQMPYHMHLNLELLEAVHLICAMLLEVPNMAANSHDAKRRVISKNFRRLLEISERQAFTAPPENVRDHVMAATRALTKGDFQKAFEVLNSLEVWRLLKNRDSILDMVKDRIKEEALRTYLFTYSSSYESLSLDQLAKMFDVSEPQVHSIVSKMMINEELHASWDQPTRCIVFHEVQHSRLQSLAFQLTEKLSILAESNERAMESRTGGGGLDLSSRRRDNNQDYAGAASGGGGYWQDKANYGQGRQGNRSGYGGGRSSGQNGQWSGQNRGGGYAGRVGSGNRGMQMDGSSRMVSLNRGVRT tor_arath Serine/threonine-protein kinase TOR TOR At1g50030 Protein TARGET OF RAPAMYCIN F2J10.19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTSSQSFVAGRPASMASPSQSHRFCGPSATASGGGSFDTLNRVIADLCSRGNPKEGAPLAFRKHVEEAVRDLSGEASSRFMEQLYDRIANLIESTDVAENMGALRAIDELTEIGFGENATKVSRFAGYMRTVFELKRDPEILVLASRVLGHLARAGGAMTSDEVEFQMKTAFDWLRVDRVEYRRFAAVLILKEMAENASTVFNVHVPEFVDAIWVALRDPQLQVRERAVEALRACLRVIEKRETRWRVQWYYRMFEATQDGLGRNAPVHSIHGSLLAVGELLRNTGEFMMSRYREVAEIVLRYLEHRDRLVRLSITSLLPRIAHFLRDRFVTNYLTICMNHILTVLRIPAERASGFIALGEMAGALDGELIHYLPTIMSHLRDAIAPRKGRPLLEAVACVGNIAKAMGSTVETHVRDLLDVMFSSSLSSTLVDALDQITISIPSLLPTVQDRLLDCISLVLSKSHYSQAKPPVTIVRGSTVGMAPQSSDPSCSAQVQLALQTLARFNFKGHDLLEFARESVVVYLDDEDAATRKDAALCCCRLIANSLSGITQFGSSRSTRAGGRRRRLVEEIVEKLLRTAVADADVTVRKSIFVALFGNQCFDDYLAQADSLTAIFASLNDEDLDVREYAISVAGRLSEKNPAYVLPALRRHLIQLLTYLELSADNKCREESAKLLGCLVRNCERLILPYVAPVQKALVARLSEGTGVNANNNIVTGVLVTVGDLARVGGLAMRQYIPELMPLIVEALMDGAAVAKREVAVSTLGQVVQSTGYVVTPYKEYPLLLGLLLKLLKGDLVWSTRREVLKVLGIMGALDPHVHKRNQQSLSGSHGEVPRGTGDSGQPIPSIDELPVELRPSFATSEDYYSTVAINSLMRILRDASLLSYHKRVVRSLMIIFKSMGLGCVPYLPKVLPELFHTVRTSDENLKDFITWGLGTLVSIVRQHIRKYLPELLSLVSELWSSFTLPGPIRPSRGLPVLHLLEHLCLALNDEFRTYLPVILPCFIQVLGDAERFNDYTYVPDILHTLEVFGGTLDEHMHLLLPALIRLFKVDAPVAIRRDAIKTLTRVIPCVQVTGHISALVHHLKLVLDGKNDELRKDAVDALCCLAHALGEDFTIFIESIHKLLLKHRLRHKEFEEIHARWRRREPLIVATTATQQLSRRLPVEVIRDPVIENEIDPFEEGTDRNHQVNDGRLRTAGEASQRSTKEDWEEWMRHFSIELLKESPSPALRTCAKLAQLQPFVGRELFAAGFVSCWAQLNESSQKQLVRSLEMAFSSPNIPPEILATLLNLAEFMEHDEKPLPIDIRLLGALAEKCRVFAKALHYKEMEFEGPRSKRMDANPVAVVEALIHINNQLHQHEAAVGILTYAQQHLDVQLKESWYEKLQRWDDALKAYTLKASQTTNPHLVLEATLGQMRCLAALARWEELNNLCKEYWSPAEPSARLEMAPMAAQAAWNMGEWDQMAEYVSRLDDGDETKLRGLASPVSSGDGSSNGTFFRAVLLVRRAKYDEAREYVERARKCLATELAALVLESYERAYSNMVRVQQLSELEEVIEYYTLPVGNTIAEERRALIRNMWTQRIQGSKRNVEVWQALLAVRALVLPPTEDVETWLKFASLCRKSGRISQAKSTLLKLLPFDPEVSPENMQYHGPPQVMLGYLKYQWSLGEERKRKEAFTKLQILTRELSSVPHSQSDILASMVSSKGANVPLLARVNLKLGTWQWALSSGLNDGSIQEIRDAFDKSTCYAPKWAKAWHTWALFNTAVMSHYISRGQIASQYVVSAVTGYFYSIACAANAKGVDDSLQDILRLLTLWFNHGATADVQTALKTGFSHVNINTWLVVLPQIIARIHSNNRAVRELIQSLLIRIGENHPQALMYPLLVACKSISNLRRAAAQEVVDKVRQHSGALVDQAQLVSHELIRVAILWHEMWHEALEEASRLYFGEHNIEGMLKVLEPLHDMLDEGVKKDSTTIQERAFIEAYRHELKEAHECCCNYKITGKDAELTQAWDLYYHVFKRIDKQLASLTTLDLESVSPELLLCRDLELAVPGTYRADAPVVTISSFSRQLVVITSKQRPRKLTIHGNDGEDYAFLLKGHEDLRQDERVMQLFGLVNTLLENSRKTAEKDLSIQRYSVIPLSPNSGLIGWVPNCDTLHHLIREHRDARKIILNQENKHMLSFAPDYDNLPLIAKVEVFEYALENTEGNDLSRVLWLKSRSSEVWLERRTNYTRSLAVMSMVGYILGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRTNKDSVMAMMEAFVHDPLINWRLFNFNEVPQLALLGNNNPNAPADVEPDEEDEDPADIDLPQPQRSTREKEILQAVNMLGDANEVLNERAVVVMARMSHKLTGRDFSSSAIPSNPIADHNNLLGGDSHEVEHGLSVKVQVQKLINQATSHENLCQNYVGWCPFW eif3h_arath Eukaryotic translation initiation factor 3 subunit H TIF3H1 Eukaryotic translation initiation factor 3 subunit 3 eIF-3-gamma eIF3 p38 subunit T16B5.2 At1g10840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATMARSFLQAISKDEAVAPPLRVVQIEGLAVLKIIKHCKEFSPTLVTGQLLGLDVGSVLEVTNCFPFPVRDDDEEIEADGANYQLEMMRCLREVNVDNNTVGWYQSTVLGSYQTVELIETFMNYQENIKRCVCIIYDPSKADLGVLALKALKLSDSFMELYRGGNFTGEKLREKNFSWMDIFEEIPIKVSNSALVSAFMTELETDTPVSQGDYDRLHSSTTPFLENNMEFLIKCMDDLSMEQQKFQYYYRNLSRQQAQQQAWLQKRRTENMARKSAGEEPLPEEDPSNPIFKAIPEPSRLESFLITNQVSNFCGQINGVAGQNFSRLYLTKALHDN tif3c1-atpk1 1445598 n/a 1445600 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell n/a 1445601 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell n/a 1445602 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell association association false false false f1a f1c TOR was present in eIF3c immunoprecipitates only when suspension cultures were treated with auxin (Figure 1C). In contrast, S6K1 accumulated in the eIF3c pellet after a 6h incubation with Torin-1, but no S6K1 precipitation was seen 6 h after NAA treatment. Overall, these results suggest that eIF3 associates with S6K1 upon Torin-1 treatment, and with TOR in the presence of auxin. tor-atpk1 1445598 n/a 1445600 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell n/a 1445602 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell n/a 1445601 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell association association false false false f1a tif3c1-atpk1-1 1445598 n/a 1445601 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell n/a 1445602 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physical association physical association false false false f1c TOR was present in eIF3c immunoprecipitates only when suspension cultures were treated with auxin (Figure 1C). In contrast, S6K1 accumulated in the eIF3c pellet after a 6h incubation with Torin-1, but no S6K1 precipitation was seen 6 h after NAA treatment. Overall, these results suggest that eIF3 associates with S6K1 upon Torin-1 treatment, and with TOR in the presence of auxin. tif3c1-atpk1-2 1445598 n/a 1445600 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell n/a 1445601 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physical association physical association false false false f1c TOR was present in eIF3c immunoprecipitates only when suspension cultures were treated with auxin (Figure 1C). In contrast, S6K1 accumulated in the eIF3c pellet after a 6h incubation with Torin-1, but no S6K1 precipitation was seen 6 h after NAA treatment. Overall, these results suggest that eIF3 associates with S6K1 upon Torin-1 treatment, and with TOR in the presence of auxin. tif3h1-atpk1 1445598 n/a 1445600 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell n/a 1445603 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell n/a 1445602 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell association association false false false f6h TOR was present in eIF3c immunoprecipitates only when suspension cultures were treated with auxin (Figure 1C). In contrast, S6K1 accumulated in the eIF3c pellet after a 6h incubation with Torin-1, but no S6K1 precipitation was seen 6 h after NAA treatment. Overall, these results suggest that eIF3 associates with S6K1 upon Torin-1 treatment, and with TOR in the presence of auxin. tor-atpk1-1 1445598 n/a 1445600 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell n/a 1445603 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell n/a 1445602 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell association association false false false f6h TOR was present in eIF3c immunoprecipitates only when suspension cultures were treated with auxin (Figure 1C). In contrast, S6K1 accumulated in the eIF3c pellet after a 6h incubation with Torin-1, but no S6K1 precipitation was seen 6 h after NAA treatment. Overall, these results suggest that eIF3 associates with S6K1 upon Torin-1 treatment, and with TOR in the presence of auxin. atpk1-tif3h1 1445598 n/a 1445600 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell n/a 1445602 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell n/a 1445603 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell association association false false false f6h TOR was present in eIF3c immunoprecipitates only when suspension cultures were treated with auxin (Figure 1C). In contrast, S6K1 accumulated in the eIF3c pellet after a 6h incubation with Torin-1, but no S6K1 precipitation was seen 6 h after NAA treatment. Overall, these results suggest that eIF3 associates with S6K1 upon Torin-1 treatment, and with TOR in the presence of auxin. tif3h1-atpk1-1 1445599 n/a 1445600 predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1445603 predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false sf6