MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lee-2013b-1 General interaction mode of CIDE:CIDE complex revealed by a mutation study of the Drep2 CIDE domain. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Lee SM., Park HH. FEBS Lett. (0014-5793) 2013 lee-2013b-2 General interaction mode of CIDE:CIDE complex revealed by a mutation study of the Drep2 CIDE domain. in vitro In vitro bn-page blue native page bn-page experimental particp experimental participant identification experimental particp Lee SM., Park HH. FEBS Lett. (0014-5793) 2013 q9u787_drome Drep2 Drep-2 Rep2 drep2 CG1975 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAREESRGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTVLLLLRQGERWYPTGVDVIKAAISAIPKIVCETIHALELHDETPSWKIMDNKGRVTVVLHWDQRQGGGSGGGESGGAGGGVGSMCSRLGSSNGLLSSDKYSPSKKGLSAQSSLDNKSVSSQSSQPRYASPQITVISDDGPASIYHPGGVVLPPGVVIPGGSRRLSKQGSSFDSTVGVGVGAVHVHTPECAHHAHTPSRAGSPSTTECDFHCCALHEEGRKIAVHKSVATSPIQDGSSSPQPQSAPSVMDPMLGGSGGGGSGSMQRRSSGAKGHVRFLDIAPERDSSESETENTVMEDDKTTTEKFLLLIDQLSVDQKRHLSIKDIGIILERLNSKILDVERLDRESESDDCYNWTIKATIRGDALRELGVIYNANYYAISEHPGYKEELEENGEEVEEEEEEDEEDRI mint o61464_drome Drep1 Drep-1 Rep1 drep1 CG8357 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly METAANSGDSKKPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEEYFRTLDENTELVAVFPGEHWIDPTHYVTITTPHGNEAGTGNGELNGGGEGDTTDANNSESARIRQLVGQLQNNLCNVSVMNDADLDSLSNMDPNSLVDITGKEFMEQLKDAGRPLCAKRNAEDRLNLLKLKLLKAGAIFCSERYPEDAEAIDREIGRQLNEAESGQMSTTTTSNTRTIEVVQCDNQNTTITITVGEATTTCATASGAMGSSAAEAAANEANANPNRNPNANGDI q0e9b7_drome Drep3 Drep-3 Rep3 BcDNA:AT08574 CG13187 DREP-3 Dmel\CG8364 drep-3 drep3 CG8364 Dmel_CG8364 DREP3 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTAMNADETKLAGMPQGAEEEQEPEREQKKESDGAAAAAGVQCDPDSRIVAPPPRQRTLTRTAELDADCEDIELDADDGLDDAADSITLELALSPHSSATPTPSPTTADEDFAQLDNSKPFKIKDITRNIRKAVVATTLSELRTKVSLKFERAQPAIHLDCDGTEVDDEEYFSTLEPNAELIAVFPGEQWRDPSDYNANLRRTSLDAQRLRSLVSKLQPNYMNDDDLDKLSNMDPNSLVDITGREPKDNEYSARSDAARLSTELSC drep_1-drep_2 1365363 drep2 Drep2 1365365 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified Q9U787:p.Lys40Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false o61464_drome Drep1 1365366 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2 mint drep-2 1365363 drep2 Drep2 1365365 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 8.0 direct interaction direct interaction false false false f2 mint drep-2 1365363 drep2 Drep2 1365365 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 10.0 direct interaction direct interaction false false false f2 mint drep_2-drep_3-2 1365363 drep2 Drep2 1365365 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified Q9U787:p.Lys40Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drep-3 Drep3 1365367 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3 mint drep_1-drep_2-1 1365364 drep2 Drep2 1365365 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified Q9U787:p.Lys40Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false o61464_drome Drep1 1365366 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f4 mint drep_2-drep_3-3 1365364 drep2 Drep2 1365365 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9U787:p.Lys40Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false drep-3 Drep3 1365367 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f4 mint