MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint fr_mont-2013-3 Beclin-1 is required for chromosome congression and proper outer kinetochore assembly. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Frémont S., Gérard A., Galloux M., Janvier K., Karess R.E., Berlioz-Torrent C. clarisse.berlioz@inserm.fr EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation fr_mont-2013-1 Beclin-1 is required for chromosome congression and proper outer kinetochore assembly. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Frémont S., Gérard A., Galloux M., Janvier K., Karess R.E., Berlioz-Torrent C. clarisse.berlioz@inserm.fr EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation fr_mont-2013-2 Beclin-1 is required for chromosome congression and proper outer kinetochore assembly. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Frémont S., Gérard A., Galloux M., Janvier K., Karess R.E., Berlioz-Torrent C. clarisse.berlioz@inserm.fr EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation zwint_human ZW10 interactor ZW10-interacting protein 1 ZWINT protein protein human Homo sapiens Human MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK becn1-zwint 1420321 n/a 1420324 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell n/a 1420325 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell colocalization colocalization false false false f5f becn1-zwint-1 1420321 n/a 1420324 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell n/a 1420325 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell tag mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5g zwint-becn1 1420322 n/a Zwint-1 1420324 unspecified role unspecified role bait bait living cell living cell n/a 1420325 unspecified role unspecified role prey prey living cell living cell tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5a zwint-becn1-1 1420323 n/a 1420324 unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1420325 unspecified role unspecified role prey prey purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false f5b