MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ciano-2013-1 Conformation-specific crosslinking of mitochondrial complex I. in vitro In vitro crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Ciano M., Fuszard M., Heide H., Botting CH., Galkin A. FEBS Lett. (0014-5793) 2013 ndua9_bovin NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial NDUFA9 NADH-ubiquinone oxidoreductase 39 kDa subunit Complex I-39kD protein protein bovin Bos taurus (Bovine) Bovine MAAAVHPRVVRVLPMSRSSVPALAASVFHSPPQRQLHHAVIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGDLGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKEAGVEKFIHISHLNADIKSSSKYLRSKAVGEKEVRETFPEATIIKPAEIFGREDRFLNYFANIRWFGGVPLISLGKKTVKQPVYIVDVTKGIINAIKDPDARGKTFAFVGPSRYLLFDLVQYVFAVAHRPFLPYPLPHFAYRWIGRLFEISPFEPWTTRDKVERIHTTDKILPHLPGLEDLGVEATPLELKAIEVLRRHRTYRWLSSEIEDVQPAKTIPTSGP nu3m_bovin NADH-ubiquinone oxidoreductase chain 3 MT-ND3 MTND3 NADH3 ND3 NADH dehydrogenase subunit 3 protein protein bovin Bos taurus (Bovine) Bovine MNLMLALLTNFTLATLLVIIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTANLNTMLTMALFLIILLAVSLAYEWTQKGLEWTE mt_nd3-ndufa9 1365309 ndua9_bovin NDUFA9 1365310 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level nu3m_bovin ND3 1365311 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false mint f2 t1 f3