MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint jergic-2013-2 A direct proofreader-clamp interaction stabilizes the Pol III replicase in the polymerization mode. in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Jergic S., Horan N.P., Elshenawy M.M., Mason C.E., Urathamakul T., Ozawa K., Robinson A., Goudsmits J.M., Wang Y., Pan X., Beck J.L., van Oijen A.M., Huber T., Hamdan S.M., Dixon N.E. nickd@uow.edu.au EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation jergic-2013-1 A direct proofreader-clamp interaction stabilizes the Pol III replicase in the polymerization mode. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Jergic S., Horan N.P., Elshenawy M.M., Mason C.E., Urathamakul T., Ozawa K., Robinson A., Goudsmits J.M., Wang Y., Pan X., Beck J.L., van Oijen A.M., Huber T., Hamdan S.M., Dixon N.E. nickd@uow.edu.au EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation jergic-2013-3 A direct proofreader-clamp interaction stabilizes the Pol III replicase in the polymerization mode. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jergic S., Horan N.P., Elshenawy M.M., Mason C.E., Urathamakul T., Ozawa K., Robinson A., Goudsmits J.M., Wang Y., Pan X., Beck J.L., van Oijen A.M., Huber T., Hamdan S.M., Dixon N.E. nickd@uow.edu.au EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation dpo3b_ecoli Beta sliding clamp dnaN Beta-clamp processivity factor DNA polymerase III beta sliding clamp subunit JW3678 b3701 protein protein ecoli Escherichia coli (strain K12) MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL This sequence has been withdrawn from Uniprot. dpo3e_ecoli DNA polymerase III subunit epsilon dnaQ mutD b0215 JW0205 protein protein ecoli Escherichia coli (strain K12) MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEIAAHEARLDLVQKKGGSCLWRA hole_ecoli DNA polymerase III subunit theta holE b1842 JW1831 protein protein ecoli Escherichia coli (strain K12) MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK 3667D87327E96556 dpo3a_ecoli DNA polymerase III subunit alpha dnaE polC b0184 JW0179 protein protein ecoli Escherichia coli (strain K12) MSEPRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFTNLCGLVKFYGAGHGAGIKPIVGADFNVQCDLLGDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSLLRGNSALVDECVAFYEEHFPDRYFLELIRTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSSDFDAHEIRVAIHDGFTLDDPKRPRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQFPTGDMSTEDYLVKRAKEGLEERLAFLFPDEEERLKRRPEYDERLETELQVINQMGFPGYFLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRRAKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKILPPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDTKKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEEPEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTERGKVITAAGLVVAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRILIVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEPHRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD dnan-dnaq-1 1420136 n/a Beta 1420139 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a Epsilon 1420140 unspecified role unspecified role neutral component neutral component purified purified P03007:p.Gln182Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false figure 3B dnan-dnaq-2 1420136 n/a Epsilon 1420140 unspecified role unspecified role neutral component neutral component purified purified P03007:p.[Thr183Leu;Met185_Phe187delinsProLeuPro] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a Beta 1420139 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false figure 3B dnae-dnan-1 1420136 n/a Theta 1420141 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a Epsilon 1420140 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a Beta 1420139 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a alpha 1420142 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false figure 3C dnan-dnaq-4 1420136 n/a alpha 1420142 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a Beta 1420139 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a Epsilon 1420140 unspecified role unspecified role neutral component neutral component purified purified P03007:p.[Thr183Leu;Met185_Phe187delinsProLeuPro] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a Theta 1420141 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false figure 3C dnae-dnan-2 1420136 n/a alpha 1420142 unspecified role unspecified role neutral component neutral component purified purified P10443:p.[Ala921Leu;Met923Leu] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a Beta 1420139 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a Epsilon 1420140 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a Theta 1420141 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false figure 4b, supplementary Figure 4 dnae-dnan-3 1420136 n/a Beta 1420139 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a alpha 1420142 unspecified role unspecified role neutral component neutral component purified purified P10443:p.[Ala921Leu;Met923Leu] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false figure 4a dnae-dnan-mutant 1420136 n/a Epsilon 1420140 unspecified role unspecified role neutral component neutral component purified purified P03007:p.Gln182Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a Theta 1420141 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a alpha 1420142 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false figure 3C dnan-1 1420136 n/a Beta 1420139 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supplementary Figure 2C, Supplementary Figure 2D dnan-1 1420136 n/a Beta 1420139 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false Supplementary Figure 2A dnan-dnaq 1420137 n/a Epsilon 1420140 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P03007:p.Gln182Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false peptide sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a Beta 1420139 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 1420137 figure 3A, Supplementary Figure 3A dnaq-dnan 1420137 n/a Beta 1420139 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a Epsilon 1420140 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false peptide sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P03007:p.[Thr183Leu;Met185_Phe187delinsProLeuPro] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false 1420137 figure 3A, Supplementary Figure 3A dnan-dnaq-6 1420138 n/a Beta 1420139 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a Epsilon 1420140 unspecified role unspecified role neutral component neutral component purified purified P03007:p.[Thr183Leu;Met185_Phe187delinsProLeuPro] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false supp. figure 3B dnan-1 1420138 n/a Beta 1420139 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false Supplementary Figure 3B