MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint park-2013-1 Crystal structure of Cmr5 from Pyrococcus furiosus and its functional implications. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Park JH., Sun J., Park SY., Hwang HJ., Park MY., Shin M., Kim JS. FEBS Lett. (0014-5793) 2013 park-2013-2 Crystal structure of Cmr5 from Pyrococcus furiosus and its functional implications. in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom experimental particp experimental participant identification experimental particp Park JH., Sun J., Park SY., Hwang HJ., Park MY., Shin M., Kim JS. FEBS Lett. (0014-5793) 2013 cmr5_pyrfu CRISPR system Cmr subunit Cmr5 cmr5 CRISPR type III-B/RAMP module-associated protein Cmr5 PF1125 protein protein pyrfu Pyrococcus furiosus MEVHMLSKDNKKSIRKTLEQRRGEYAYYVIKEVADLNDKQLEEKYASLVKKAPVMILSNGLLQTLAFLLAKAETSPEKANQILSRVNEYPPRFIEKLGNDKDEHLLLYLHIVYWLRENVDRNIDVKTLLSQDYSKVLWATKEAIALLNWMRRFAVAMLKEEGKENEGSS cmr4_pyrfu CRISPR system Cmr endoribonuclease Cmr4 cmr4 CRISPR type III-B/RAMP module RAMP protein Cmr4 Target RNase Cmr4 PF1126 protein protein pyrfu Pyrococcus furiosus MKAYLVGLYTLTPTHPGSGTELGVVDQPIQRERHTGFPVIWGQSLKGVLRSYLKLVEKVDEEKINKIFGPPTEKAHEQAGLISVGDAKILFFPVRSLKGVYAYVTSPLVLNRFKRDLELAGVKNFQTEIPELTDTAIASEEITVDNKVILEEFAILIQKDDKGILESVVKAIEQAFGNEMAEKIKGRIAIIPDDVFRDLVELSTEIVARIRINAETGTVETGGLWYEEYIPSDTLFYSLILVTPRAKDNDMALIKEVLGKINGKYLQIGGNETVGKGFVKVTLKEVTNNGGTHAK cmr4-cmr5 1353776 cmr5_pyrfu pfCmr5 1353778 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified cmr4 pfCmr4 1353779 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4c mint cmr4-cmr4 1353776 cmr4 pfCmr4 1353779 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified cmr4 pfCmr4 1353779 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4a mint cmr4-cmr5-1 1353777 cmr5_pyrfu pfCmr5 1353778 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role unspecified role unspecified role purified purified cmr4 pfCmr4 1353779 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role unspecified role unspecified role purified purified direct interaction direct interaction false false false f4b mint