UniProt UniProt http://www.uniprot.org hunter-2013-3 Chromatin immunoprecipitation and microarray analysis suggest functional cooperation between Kaposi's Sarcoma-associated herpesvirus ORF57 and K-bZIP. human-bcbl_1 Homo sapiens lymphoma cell line bcbl_1 Human BCBL-1 KSHV/HHV8-Infected body-cavity-based lymphoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hunter O.V., Sei E., Richardson R.B., Conrad N.K. Viral ORF57 and K8/K-bZIP proteins have been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus reference strain. ChIP experiments fig 3 and 4 not included. nicholas.conrad@utsouthwestern.edu J. Virol. (0022-538X) 2013 imex curation Only protein-protein interactions hunter-2013-1 Chromatin immunoprecipitation and microarray analysis suggest functional cooperation between Kaposi's Sarcoma-associated herpesvirus ORF57 and K-bZIP. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Hunter O.V., Sei E., Richardson R.B., Conrad N.K. Viral ORF57 and K8/K-bZIP proteins have been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus reference strain. ChIP experiments fig 3 and 4 not included. nicholas.conrad@utsouthwestern.edu J. Virol. (0022-538X) 2013 imex curation Only protein-protein interactions hunter-2013-2 Chromatin immunoprecipitation and microarray analysis suggest functional cooperation between Kaposi's Sarcoma-associated herpesvirus ORF57 and K-bZIP. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hunter O.V., Sei E., Richardson R.B., Conrad N.K. Viral ORF57 and K8/K-bZIP proteins have been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus reference strain. ChIP experiments fig 3 and 4 not included. nicholas.conrad@utsouthwestern.edu J. Virol. (0022-538X) 2013 imex curation Only protein-protein interactions hunter-2013-4 Chromatin immunoprecipitation and microarray analysis suggest functional cooperation between Kaposi's Sarcoma-associated herpesvirus ORF57 and K-bZIP. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hunter O.V., Sei E., Richardson R.B., Conrad N.K. Viral ORF57 and K8/K-bZIP proteins have been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus reference strain. ChIP experiments fig 3 and 4 not included. nicholas.conrad@utsouthwestern.edu J. Virol. (0022-538X) 2013 imex curation Only protein-protein interactions icp27_hhv8p mRNA export factor ICP27 homolog EB2 protein homolog ORF57 protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MVQAMIDMDIMKGILEDSVSSSEFDESRDDETDAPTLEDEQLSEPAEPPADERIRGTQSAQGIPPPLGRIPKKSQGRSQLRSEIQFCSPLSRPRSPSPVNRYGKKIKFGTAGQNTRPPPEKRPRRRPRDRLQYGRTTRGGQCRAAPKRATRRPQVNCQRQDDDVRQGVSDAVKKLRLPASMIIDGESPRFDDSIIPRHHGACFNVFIPAPPSHVPEVFTDRDITALIRAGGKDDELINKKISAKKIDHLHRQMLSFVTSRHNQAYWVSCRRETAAAGGLQTLGAFVEEQMTWAQTVVRHGGWFDEKDIDIILDTAIFVCNAFVTRFRLLHLSCVFDKQSELALIKQVAYLVAMGNRLVEACNLLGEVKLNFRGGLLLAFVLTIPGMQSRRSISARGQELFRTLLEYYRPGDVMGLLNVIVMEHHSLCRNSECAAATRAAMGSAKFNKGLFFYPLS kbzip_hhv8p E3 SUMO-protein ligase K-bZIP K8 E3 SUMO-protein transferase K-bZIP protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MPRMKDIPTKSSPGTDNSEKDEAVIEEDLSLNGQPFFTDNTDGGENEVSWTSSLLSTYVGCQPPAIPVCETVIDLTAPSQSGAPGDEHLPCSLNAETKFHIPDPSWTLSHTPPRGPHISQQLPTRRSKRRLHRKFEEERLCTKAKQGAGRPVPASVVKVGNITPHYGEELTRGDAVPAAPITPPYPRVQRPAQPTHVLFSPVFVSLKAEVCDQSHSPTRKQGRYGRVSSKAYTRQLQQALEEKDAQLCFLAARLEAHKEQIIFLRDMLMRMCQQPASPTDAPLPPC icp27-k8-4 1468266 n/a 1468270 unspecified role unspecified role bait bait infection infection n/a 1468271 unspecified role unspecified role prey prey infection infection physical association physical association false false false 1C k8-icp27-1 1468266 n/a 1468270 unspecified role unspecified role prey prey infection infection n/a 1468271 unspecified role unspecified role bait bait infection infection physical association physical association false false false 1C k8-icp27 1468267 n/a 1468270 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1468271 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 1B icp27-k8-2 1468268 n/a 1468271 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n/a 1468270 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A k8-icp27-2 1468269 n/a 1468270 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1468271 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2C