MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint wyatt-2013-1 Protease-activated alpha-2-macroglobulin can inhibit amyloid formation via two distinct mechanisms. in vitro In vitro fluorescence fluorescence technology fluorescence experimental particp experimental participant identification experimental particp Wyatt AR., Constantinescu P., Ecroyd H., Dobson CM., Wilson MR., Kumita JR., Yerbury JJ. FEBS Lett. (0014-5793) 2013 wyatt-2013-2 Protease-activated alpha-2-macroglobulin can inhibit amyloid formation via two distinct mechanisms. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy experimental particp experimental participant identification experimental particp Wyatt AR., Constantinescu P., Ecroyd H., Dobson CM., Wilson MR., Kumita JR., Yerbury JJ. FEBS Lett. (0014-5793) 2013 wyatt-2013-3 Protease-activated alpha-2-macroglobulin can inhibit amyloid formation via two distinct mechanisms. in vitro In vitro light scattering light scattering experimental particp experimental participant identification experimental particp Wyatt AR., Constantinescu P., Ecroyd H., Dobson CM., Wilson MR., Kumita JR., Yerbury JJ. FEBS Lett. (0014-5793) 2013 a4_human Amyloid-beta precursor protein APP A4 AD1 Alzheimer disease amyloid protein ABPP PreA4 Cerebral vascular amyloid peptide Protease nexin-II APPI Amyloid precursor protein Amyloid-beta A4 protein Alzheimer disease amyloid A4 protein homolog Amyloid-beta (A4) precursor protein protein protein human Homo sapiens Human MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN lysc_human Lysozyme C LYZ LZM 1,4-beta-N-acetylmuramidase C protein protein human Homo sapiens Human MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV lalba_bovin Alpha-lactalbumin LALBA ALACTA Lactose synthase B protein protein protein bovin Bos taurus (Bovine) Bovine MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL mint homomint Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins app-app-32 1351356 a4_human A beta 1-42 1351359 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false a4_human A beta 1-42 1351359 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2a f2b homomint mint lyz-lyz-2 1351356 lysc_human I59T lysozyme 1351360 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified lysc_human I59T lysozyme 1351360 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f1a f1b homomint mint lalba-lalba 1351356 lalba_bovin Alpha-lactalbumin 1351361 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified lalba_bovin Alpha-lactalbumin 1351361 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false sf3a homomint mint app-app-33 1351357 a4_human A beta 1-42 1351359 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false a4_human A beta 1-42 1351359 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2c homomint mint lyz-lyz-3 1351357 lysc_human I59T lysozyme 1351360 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified lysc_human I59T lysozyme 1351360 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false homomint mint f1c lyz-lyz-4 1351358 lysc_human I59T lysozyme 1351360 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified lysc_human I59T lysozyme 1351360 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false sf2b homomint mint