IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kourrich-2013-1 Dynamic interaction between sigma-1 receptor and Kv1.2 shapes neuronal and behavioral responses to cocaine. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kourrich S., Hayashi T., Chuang J.Y., Tsai S.Y., Su T.P., Bonci A. Membrane lysates from the nucleus accumbens (NAc) medial shell. antonello.bonci@nih.gov Cell (0092-8674) 2013 Only protein-protein interactions imex curation kourrich-2013-2 Dynamic interaction between sigma-1 receptor and Kv1.2 shapes neuronal and behavioral responses to cocaine. mouse-neuro_2_a Mus musculus albino neuroblastoma cell line neuro 2 a (N2a) neuro_2_a Mouse Albino neuroblastoma neuro 2 a cell line anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kourrich S., Hayashi T., Chuang J.Y., Tsai S.Y., Su T.P., Bonci A. antonello.bonci@nih.gov Cell (0092-8674) 2013 Only protein-protein interactions imex curation kourrich-2013-3 Dynamic interaction between sigma-1 receptor and Kv1.2 shapes neuronal and behavioral responses to cocaine. mouse-brain-cortex Mus musculus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Kourrich S., Hayashi T., Chuang J.Y., Tsai S.Y., Su T.P., Bonci A. Prefrontal cortex tissue was used. Crosslinking with DSP followed by IP. antonello.bonci@nih.gov Cell (0092-8674) 2013 Only protein-protein interactions imex curation kourrich-2013-4 Dynamic interaction between sigma-1 receptor and Kv1.2 shapes neuronal and behavioral responses to cocaine. mouse-ng108_15 Mouse NG108-15 ng108-15 Mouse neuroblastoma x Rat glioma hybrid NG108-15 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kourrich S., Hayashi T., Chuang J.Y., Tsai S.Y., Su T.P., Bonci A. Additional detail on constructs obtained from the author antonello.bonci@nih.gov Cell (0092-8674) 2013 Only protein-protein interactions imex curation kourrich-2013-5 Dynamic interaction between sigma-1 receptor and Kv1.2 shapes neuronal and behavioral responses to cocaine. mouse-ng108_15 Mouse NG108-15 ng108-15 Mouse neuroblastoma x Rat glioma hybrid NG108-15 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kourrich S., Hayashi T., Chuang J.Y., Tsai S.Y., Su T.P., Bonci A. Additional detail on constructs obtained from the author antonello.bonci@nih.gov Cell (0092-8674) 2013 Only protein-protein interactions imex curation kourrich-2013-6 Dynamic interaction between sigma-1 receptor and Kv1.2 shapes neuronal and behavioral responses to cocaine. mouse-ng108_15 Mouse NG108-15 ng108-15 Mouse neuroblastoma x Rat glioma hybrid NG108-15 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Kourrich S., Hayashi T., Chuang J.Y., Tsai S.Y., Su T.P., Bonci A. antonello.bonci@nih.gov Cell (0092-8674) 2013 Only protein-protein interactions imex curation sgmr1_mouse Sigma non-opioid intracellular receptor 1 Sigma 1-type opioid receptor Sigmar1 Oprs1 protein protein mouse Mus musculus Mouse MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS kcna2_mouse Potassium voltage-gated channel subfamily A member 2 Voltage-gated potassium channel subunit Kv1.2 Kcna2 MK2 protein protein mouse Mus musculus Mouse MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV sgmr1_rat Sigma non-opioid intracellular receptor 1 Sigma 1-type opioid receptor Sigmar1 Oprs1 protein protein rat Rattus norvegicus (Rat) Rat MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP kcna2-sigmar1 1389573 n/a 1389579 unspecified role unspecified role prey prey n/a 1389580 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5, Supp. Fig. 5B, 5C Cocaine BD1063 -a Sig-1R antagonist. kcna2-sigmar1-8 1389574 n/a 1389581 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1389580 unspecified role unspecified role bait bait physical association physical association false false false Supp 6Bb Cocaine kcna2-sigmar1-2 1389575 n/a 1389580 unspecified role unspecified role bait bait n/a 1389579 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 5A sigmar1-kcna2 1389576 n/a 1389580 unspecified role unspecified role prey prey n/a 1389581 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp Fig. 6Ab Cocaine kcna2-sigmar1-5 1389577 n/a 1389581 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1389580 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6, Supp Fig. 6Aa,6Ba Cocaine kcna2-sigmar1-7 1389578 n/a 1389580 unspecified role unspecified role neutral component neutral component n/a 1389579 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 7A Cocaine