MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint li-2013g-1 Role of Saw1 in Rad1/Rad10 complex assembly at recombination intermediates in budding yeast. ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Li F., Dong J., Eichmiller R., Holland C., Minca E., Prakash R., Sung P., Yong Shim E., Surtees J.A., Eun Lee S. jsurtees@buffalo.edu lees4@uthscsa.edu lees4@uthscsa.edu,jsurtees@buffalo.edu EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation li-2013g-2 Role of Saw1 in Rad1/Rad10 complex assembly at recombination intermediates in budding yeast. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Li F., Dong J., Eichmiller R., Holland C., Minca E., Prakash R., Sung P., Yong Shim E., Surtees J.A., Eun Lee S. jsurtees@buffalo.edu lees4@uthscsa.edu lees4@uthscsa.edu,jsurtees@buffalo.edu EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation rad10_yeast DNA repair protein RAD10 YML095C RAD10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNNTDPTSFESILAGVAKLRKEKSGADTTGSQSLEIDASKLQQQEPQTSRRINSNQVINAFNQQKPEEWTDSKATDDYNRKRPFRSTRPGKTVLVNTTQKENPLLNHLKSTNWRYVSSTGINMIYYDYLVRGRSVLFLTLTYHKLYVDYISRRMQPLSRNENNILIFIVDDNNSEDTLNDITKLCMFNGFTLLLAFNFEQAAKYIEYLNL 26891AD9CA1E3E2B saw1_yeast Single-strand annealing weakened protein 1 YAL027W SAW1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPNTRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAGADTDNAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMFQTLTLNGFSLNAGPKTLLARKIEKQPQVPNLLIENGDADALDTPVEEDIKPVIEFMYKPVINLGEIIDVHVLHRPRRHKVRTQSKQPQEE F525EF2E5347E500 rad1_yeast DNA repair protein RAD1 YPL022W RAD1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQLFYQGDSDDELQEELTRQTTQASQSSKIKNEDEPDDSNHLNEVENEDSKVLDDDAVLYPLIPNEPDDIETSKPNINDIRPVDIQLTLPLPFQQKVVENSLITEDALIIMGKGLGLLDIVANLLHVLATPTSINGQLKRALVLVLNAKPIDNVRIKEALEELSWFSNTGKDDDDTAVESDDELFERPFNVVTADSLSIEKRRKLYISGGILSITSRILIVDLLSGIVHPNRVTGMLVLNADSLRHNSNESFILEIYRSKNTWGFIKAFSEAPETFVMEFSPLRTKMKELRLKNVLLWPRFRVEVSSCLNATNKTSHNKVIEVKVSLTNSMSQIQFGLMECLKKCIAELSRKNPELALDWWNMENVLDINFIRSIDSVMVPNWHRISYESKQLVKDIRFLRHLLKMLVTSDAVDFFGEIQLSLDANKPSVSRKYSESPWLLVDEAQLVISYAKKRIFYKNEYTLEENPKWEQLIHILHDISHERMTNHLQGPTLVACSDNLTCLELAKVLNASNKKRGVRQVLLNKLKWYRKQREETKKLVKEVQSQDTFPENATLNVSSTFSKEQVTTKRRRTRGASQVAAVEKLRNAGTNVDMEVVFEDHKLSEEIKKGSGDDLDDGQEENAANDSKIFEIQEQENEILIDDGDAEFDNGELEYVGDLPQHITTHFNKDLWAEHCNEYEYVDRQDEILISTFKSLNDNCSLQEMMPSYIIMFEPDISFIRQIEVYKAIVKDLQPKVYFMYYGESIEEQSHLTAIKREKDAFTKLIRENANLSHHFETNEDLSHYKNLAERKLKLSKLRKSNTRNAGGQQGFHNLTQDVVIVDTREFNASLPGLLYRYGIRVIPCMLTVGDYVITPDICLERKSISDLIGSLQNNRLANQCKKMLKYYAYPTLLIEFDEGQSFSLEPFSERRNYKNKDISTVHPISSKLSQDEIQLKLAKLVLRFPTLKIIWSSSPLQTVNIILELKLGREQPDPSNAVILGTNKVRSDFNSTAKGLKDGDNESKFKRLLNVPGVSKIDYFNLRKKIKSFNKLQKLSWNEINELINDEDLTDRIYYFLRTEKEEQEQESTDENLESPGKTTDDNALHDHHNDVPEAPV 06FDA601F3F59B10 rad1-rad10-9 1459157 n/a 1459159 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell n/a 1459160 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell n/a 1459161 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false f6a rad1-rad10-12 1459157 n/a 1459159 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell n/a 1459161 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f6a rad1-rad10-11 1459158 n/a 1459159 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified n/a 1459161 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459160 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified association association false false false f6b f6c rad1-rad10-13 1459158 n/a 1459161 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459159 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified physical association physical association false false false f6c