MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint watanabe-2013-1 Ubiquitin-like protein MNSFβ covalently binds to Bcl-G and enhances lipopolysaccharide/interferon γ-induced apoptosis in macrophages. mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip experimental particp experimental participant identification experimental particp Watanabe J., Nakagawa M., Watanabe N., Nakamura M. FEBS J. (1742-464X) 2013 b2l14_mouse Apoptosis facilitator Bcl-2-like protein 14 Bcl2l14 protein protein mouse Mus musculus Mouse MCSTSVYDLEDIPLEDDDPNSIEFKILAFYARHHVFKNTPAVFSPKLSRTRSLSQKALGTWSTDSWTQVSLPCRGSPSSEKNISLGKKKSSWRTLFRVAEKEEGLPSSPKEIRAQGPQGPFPVERQSGFHNQHWPRSLSSVEQRLESEVVDSKVACIANRVAEIVYSWPPPDVIHSQGGSKLKERVSEILYFRFEGPCDSKNKDGEDQIISKIVELLKFSGDQLGREIKKDKALMSSFQDGLSYSTFKTITDLFLRDVDTRGESEVKARGFKAALAIDAIAKLTAIDNHPMNRMLGFGTKYLREYFSPWVQQNGGWEKILGISHEEVD mint May play a role in apoptosis ubim_mouse Ubiquitin-like protein FUBI Fau Monoclonal non-specific suppressor factor beta protein protein mouse Mus musculus Mouse MQLFVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG bcl2l14-fau 1351341 b2l14_mouse Bcl-G 1351342 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ubim_mouse MNSFβ 1351343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f1c mint bcl2l14-fau-1 1351341 b2l14_mouse Bcl-G 1351342 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ubim_mouse MNSFβ 1351343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f1c mint bcl2l14-fau-2 1351341 b2l14_mouse Bcl-G 1351342 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ubim_mouse MNSFβ 1351343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f1c mint bcl2l14-fau-3 1351341 b2l14_mouse Bcl-G 1351342 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ubim_mouse MNSFβ 1351343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f1c mint