MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint jaehme-2013-1 Evaluation of cell-free protein synthesis for the crystallization of membrane proteins--a case study on a member of the glutamate transporter family from Staphylothermus marinus. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Jaehme M., Michel H. FEBS J. (1742-464X) 2013 jaehme-2013-2 Evaluation of cell-free protein synthesis for the crystallization of membrane proteins--a case study on a member of the glutamate transporter family from Staphylothermus marinus. in vitro In vitro crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Jaehme M., Michel H. FEBS J. (1742-464X) 2013 a3dpq3_stamf Smar_1524 protein protein stamf Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) MGFWESYKRFPVIYKVAIAFVLGIVAGVIVGPPIAVIKPLGDVLIRLLKMIVVPIVLFSLVVGSASISPLKLGKVGVKIIVYYIVTSAIAVLIGIAMGLLFQPGVGVHLAGTGYSVKTVTPPSPIDVLLNIIPTNPWAALVNGNVLQIIFFAIVLGIALAYLKDSKDERLRNLGSTVLNVFDGLAEAIYKIVRGILEYMPYGVFALIGYAVAITGPGVLGPLGVAVVALYLGLFIHIFATYGSILAVFRFNIIKFLAKAKDAMLTAFVTRSSSGTLPITMSVAEEKMGIKKSIYAFTLPLGATINMDGTAMYQAIATMFIANALGIHLTVVHYGMIVLTAVLASIGTAGVPGAGLIMLALVLQAVGLPLTEPNVALAYSLIAGIDVILDMGRTMVNVTGDLTGTLIVAKTENETDLSKWK mint a3dpq3-a3dpq3 1350823 gltsm GltSM 1350825 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gltsm GltSM 1350825 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4 mint a3dpq3-1 1350824 gltsm GltSM 1350825 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 3.0 direct interaction direct interaction false false false f5 mint