IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pos-2012-2 Crystal structure of the HLA-DM-HLA-DR1 complex defines mechanisms for rapid peptide selection. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Pos W., Sethi D.K., Call M.J., Schulze M.S., Anders A.K., Pyrdol J., Wucherpfennig K.W. Binding regions taken from PDB submission. kai_wucherpfennig@dfci.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation pos-2012-1 Crystal structure of the HLA-DM-HLA-DR1 complex defines mechanisms for rapid peptide selection. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pos W., Sethi D.K., Call M.J., Schulze M.S., Anders A.K., Pyrdol J., Wucherpfennig K.W. Binding regions taken from PDB submission. kai_wucherpfennig@dfci.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation pos-2012-3 Crystal structure of the HLA-DM-HLA-DR1 complex defines mechanisms for rapid peptide selection. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Pos W., Sethi D.K., Call M.J., Schulze M.S., Anders A.K., Pyrdol J., Wucherpfennig K.W. Binding regions taken from PDB submission. kai_wucherpfennig@dfci.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation dma_human HLA class II histocompatibility antigen, DM alpha chain HLA-DMA DMA RING6 MHC class II antigen DMA Really interesting new gene 6 protein protein protein human Homo sapiens Human MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWHDHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD dra_human HLA class II histocompatibility antigen, DR alpha chain HLA-DRA MHC class II antigen DRA HLA-DRA1 protein protein human Homo sapiens Human MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIKGLRKSNAAERRGPL d7rig0_human HLA-DRB1 protein protein human Homo sapiens Human MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS mbp_human Myelin basic protein MBP Myelin A1 protein Myelin membrane encephalitogenic protein protein protein human Homo sapiens Human MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR dmb_human HLA class II histocompatibility antigen, DM beta chain HLA-DMB DMB RING7 MHC class II antigen DMB Really interesting new gene 7 protein protein protein human Homo sapiens Human MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS gkqnclklatk peptide GKQNCLKLATK peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide human Homo sapiens Human GKQNCLKLATK hla_dma-hla_dra-2 1385365 n/a 1385368 unspecified role unspecified role neutral component neutral component P28067:p.Gln92Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P28067:p.Asn151Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P28067:p.Asn151Arg mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1385369 unspecified role unspecified role neutral component neutral component P01903:p.Phe76Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P01903:p.Val90Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false P01903:p.Phe76Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P01903:p.Arg125Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1385370 unspecified role unspecified role neutral component neutral component p.Cys59Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1385371 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 3F, Supp. Fig. 5A, 6D DRalpha Gln82Ala mutation reduces HLA-DMA activity in a pH-dependent manner hla_dma-hla_dra-3 1385365 n/a 1385369 unspecified role unspecified role neutral component neutral component P01903:p.Val90Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1385370 unspecified role unspecified role neutral component neutral component p.Cys59Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1385371 unspecified role unspecified role neutral component neutral component region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 5F, Supp. Fig. 5B gkqnclklat_p-hla_dma 1385366 n/a 1385368 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1385370 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1385372 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P28068:p.Asn92Asp mutation mutation certain certain sequence position certain certain certain sequence position certain false P28068:p.Cys64Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1385369 unspecified role unspecified role neutral component neutral component P01903:p.Val90Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1385373 unspecified role unspecified role neutral component neutral component c-terminal dnp tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 1, Supp. Table 1 Rworking = 0.19 Rfree = 0.24 (4fqx), Rworking = 0.2 Rfree = 0.25 (4gbx) 2.6A (4fqx), 3.0A (4gbx) hla_dma-hla_dra-1 1385367 n/a 1385368 unspecified role unspecified role bait bait c-terminal biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P28067:p.Asn151Arg mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false P28067:p.Asn151Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1385370 unspecified role unspecified role prey prey p.Cys59Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false n-terminal clip peptide fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 1385369 unspecified role unspecified role prey prey P01903:p.Phe76Trp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false P01903:p.Phe76Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P01903:p.Glu80Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false P01903:p.Val90Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false P01903:p.Arg125Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P01903:p.Phe76Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false 1385367 Fig. 5E, Supp Fig. 3E, 5B pH 7.0 Kd varies from 2.7E-6 to 1.54E-5M from pH 5-7.