IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gul-2013-1 Functional reconstitution and osmoregulatory properties of the ProU ABC transporter from Escherichia coli. in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Gul N., Poolman B. Proteins were purified by gel-filtration and subsequently the protein complexes were reconstituted in a proteoliposome. ProX has an N-terminal lipid anchor signal sequence (aa 23-88 of oppA) and GGGSAGGGS linker. b.poolman@rug.nl Mol. Membr. Biol. (0968-7688) 2013 Only protein-protein interactions imex curation gul-2013-2 Functional reconstitution and osmoregulatory properties of the ProU ABC transporter from Escherichia coli. in vitro In vitro filter trap assay filter trap assay Filter retention assay Filter retention assay predetermined predetermined participant predetermined Gul N., Poolman B. Proteins were purified by gel-filtration and subsequently the protein complexes were reconstituted in a proteoliposome. ProX has an N-terminal lipid anchor signal sequence (aa 23-88 of oppA) and GGGSAGGGS linker. b.poolman@rug.nl Mol. Membr. Biol. (0968-7688) 2013 Only protein-protein interactions imex curation prox_ecoli Glycine betaine/proline betaine-binding periplasmic protein proX proU b2679 JW2654 GBBP protein protein ecoli Escherichia coli (strain K12) MRHSVLFATAFATLISTQTFAADLPGKGITVNPVQSTITEETFQTLLVSRALEKLGYTVNKPSEVDYNVGYTSLASGDATFTAVNWTPLHDNMYEAAGGDKKFYREGVFVNGAAQGYLIDKKTADQYKITNIAQLKDPKIAKLFDTNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYYTWTPYWVSNELKPGKDVVWLQVPFSALPGDKNADTKLPNGANYGFPVSTMHIVANKAWAEKNPAAAKLFAIMQLPVADINAQNAIMHDGKASEGDIQGHVDGWIKAHQQQFDGWVNEALAAQK prow_ecoli Glycine betaine/proline betaine transport system permease protein ProW proW b2678 JW2653 protein protein ecoli Escherichia coli (strain K12) MADQNNPWDTTPAADSAAQSADAWGTPTTAPTDGGGADWLTSTPAPNVEHFNILDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVFALIAWQISGVGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLARSPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSRSRGNRRWYTTGPVGLLTRPFIK prov_ecoli Glycine betaine/proline betaine transport system ATP-binding protein ProV proV b2677 JW2652 protein protein ecoli Escherichia coli (strain K12) MAIKLEIKNLYKIFGEHPQRAFKYIEQGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRTPNGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKFVGAVSIDSLKTALTQQQGLDAALIDAPLAVDAQTPLSELLSHVGQAPCAVPVVDEDQQYVGIISKGMLLRALDREGVNNG glycine betaine glycine betaine (trimethylammoniumyl)acetate 1-carboxy-N,N,N-trimethylmethanaminium inner salt 2-N,N,N-trimethylammonio acetate abromine acidol Bet betaine Betaine Glycine betaine N,N,N-trimethylammonioacetate Trimethylaminoacetate trimethylglycine trimethylglycocoll (trimethylammonio)acetate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) KWIUHFFTVRNATP-UHFFFAOYSA-N prov-prow 1446209 n/a 1446211 unspecified role unspecified role neutral component neutral component oppa lipid anchoring signal sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false lacll Lactococcus lactis subsp. lactis Streptococcus lactis n/a 1446212 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1446213 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3 prov-prow-1 1446209 n/a 1446212 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1446213 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 3 glycine_betaine-prox 1446210 n/a 1446214 unspecified role unspecified role neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1446211 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false oppa lipid anchoring signal sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false lacll Lactococcus lactis subsp. lactis Streptococcus lactis direct interaction direct interaction false false false Fig. 4