MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint milles-2013-3 Facilitated aggregation of FG nucleoporins under molecular crowding conditions. in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret experimental particp experimental participant identification experimental particp Milles S., Huy Bui K., Koehler C., Eltsov M., Beck M., Lemke EA. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation milles-2013-1 Facilitated aggregation of FG nucleoporins under molecular crowding conditions. in vitro In vitro fluorescence fluorescence technology fluorescence experimental particp experimental participant identification experimental particp Milles S., Huy Bui K., Koehler C., Eltsov M., Beck M., Lemke EA. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation milles-2013-2 Facilitated aggregation of FG nucleoporins under molecular crowding conditions. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy experimental particp experimental participant identification experimental particp Milles S., Huy Bui K., Koehler C., Eltsov M., Beck M., Lemke EA. EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation nu153_human Nuclear pore complex protein Nup153 Nucleoporin Nup153 153 kDa nucleoporin NUP153 protein protein human Homo sapiens Human MASGAGGVGGGGGGKIRTRRCHQGPIKPYQQGRQQHQGILSRVTESVKNIVPGWLQRYFNKNEDVCSCSTDTSEVPRWPENKEDHLVYADEESSNITDGRITPEPAVSNTEEPSTTSTASNYPDVLTRPSLHRSHLNFSMLESPALHCQPSTSSAFPIGSSGFSLVKEIKDSTSQHDDDNISTTSGFSSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTPYQAPVRRQMKAKQLSAQSYGVTSSTARRILQSLEKMSSPLADAKRIPSIVSSPLNSPLDRSGIDITDFQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEKNMTPGQNREQRESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKPLEEEEMEVPVLPKISLPITSSSLPTFNFSSPEITTSSPSPINSSQALTNKVQMTSPSSTGSPMFKFSSPIVKSTEANVLPPSSIGFTFSVPVAKTAELSGSSSTLEPIISSSAHHVTTVNSTNCKKTPPEDCEGPFRPAEILKEGSVLDILKSPGFASPKIDSVAAQPTATSPVVYTRPAISSFSSSGIGFGESLKAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPGTKSGFKGFDTSSSSSNSAASSSFKFGVSSSSSGPSQTLTSTGNFKFGDQGGFKIGVSSDSGSINPMSEGFKFSKPIGDFKFGVSSESKPEEVKKDSKNDNFKFGLSSGLSNPVSLTPFQFGVSNLGQEEKKEELPKSSSAGFSFGTGVINSTPAPANTIVTSENKSSFNLGTIETKSASVAPFTCKTSEAKKEEMPATKGGFSFGNVEPASLPSASVFVLGRTEEKQQEPVTSTSLVFGKKADNEEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNSSSSSSTPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKLATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFGANQTPTFGQSQGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK nup49_yeast Nucleoporin NUP49/NSP49 NUP49 NSP49 YGL172W G1648 Nuclear pore protein NUP49/NSP49 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFGLNKASSTPAGGLFGQASGASTGNANTGFSFGGTQTGQNTGPSTGGLFGAKPAGSTGGLGASFGQQQQQSQTNAFGGSATTGGGLFGNKPNNTANTGGGLFGANSNSNSGSLFGSNNAQTSRGLFGNNNTNNINNSSSGMNNASAGLFGSKPAGGTSLFGNTSTSSAPAQNQGMFGAKPAGTSLFGNNAGNTTTGGGLFGSKPTGATSLFGSSNNNNNNNNSNNIMSASGGLFGNQQQQLQQQPQMQCALQNLSQLPITPMTRISELPPQIRQEIEQLDQYIQKQVQISHHLKADTIDHDELIDSIPRDVAYLLKSESATSQYLKQDLKKISSFKSLIDEDLLDTQTFSVLLQQLLTPGSKISSNDLDKFFQKKIHLYEKKLEDYCRILSDIETAVNGIDTDLFGAPNNPNSTAITADLGSSEAENLLQLKTGLAAIVSTVIEEFTLFMDIAERIAVLHQKTKTLASLSI nup153-nup153-2 1389217 nu153_human hNUP153 1389220 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence donor fluorescence donor purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nu153_human hNUP153 1389220 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false homomint mint f1d f2a f2b sf2 nup153-nup153-3 1389217 nu153_human hNUP153 1389220 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence donor fluorescence donor purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nu153_human hNUP153 1389220 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false homomint mint f1d f1f nup49-nup49-2 1389217 nup49_yeast yNUP49 1389221 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence donor fluorescence donor purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nup49_yeast yNUP49 1389221 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false sf1c homomint mint nup153-nup153 1389218 n/a hNUP153 1389220 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a hNUP153 1389220 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f1a f2c nup49-nup49 1389218 nup49_yeast yNUP49 1389221 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nup49_yeast yNUP49 1389221 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false sf1a homomint mint nup153-nup153-1 1389219 nu153_human hNUP153 1389220 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nu153_human hNUP153 1389220 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f1b f1c homomint mint nup49-nup49-1 1389219 nup49_yeast yNUP49 1389221 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nup49_yeast yNUP49 1389221 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false sf1b homomint mint