IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ragusa-2012-4 Architecture of the Atg17 complex as a scaffold for autophagosome biogenesis. in vitro In vitro comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Ragusa M.J., Stanley R.E., Hurley J.H. james.hurley@nih.gov Cell (0092-8674) 2012 Only protein-protein interactions imex curation ragusa-2012-2 Architecture of the Atg17 complex as a scaffold for autophagosome biogenesis. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ragusa M.J., Stanley R.E., Hurley J.H. The Materials and Methods state that K. lactis was used for light scattering experiments, but Fig. 3A states the crystallization constructs were used, and 4D uses constructs only described for S. cerevisiae. It has been assumed that the text correctly describes the constructs. james.hurley@nih.gov Cell (0092-8674) 2012 Only protein-protein interactions imex curation ragusa-2012-1 Architecture of the Atg17 complex as a scaffold for autophagosome biogenesis. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ragusa M.J., Stanley R.E., Hurley J.H. james.hurley@nih.gov Cell (0092-8674) 2012 Only protein-protein interactions imex curation ragusa-2012-3 Architecture of the Atg17 complex as a scaffold for autophagosome biogenesis. in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Ragusa M.J., Stanley R.E., Hurley J.H. james.hurley@nih.gov Cell (0092-8674) 2012 Only protein-protein interactions imex curation c5dfj6_lactc Autophagy-related protein 17 KLTH0D15642g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MNEAVIEKLLENSRKFLTGAKLICQESNDHLTTTKLRIREWQKFQSKLHFVLDCIQQQTKFLSEILLREGIGRNLIEEEWSQTVLVRLVNDMKFWQNEITKMMNKLDNITNEIDQQHNSKLGDFISRDSSHILDSKLNEIPTIRKQVENITRQYQTMLAKVQSQLVESRMKGLRDEFSSKFGDQCRENLKLNEEFTNEADQLEQELADFLKSFTDHFDKCSALSSRSVSPEDAQNLFEIVERDDKDLAAINSLLQDAAIDVASFVRKVNMLLDERDADKAKMQATLSKLLTELRKHEEYISVFEGISALIQKFKASCLEDIRQTRNLLDFYANFERSYHNLLKEVKRRKETAAKLSQILKSCETQLEQINTADLRERQMFLLENGNYLPETIWPDEIGSLSPLYTLNYEVRKV c5deb9_lactc KLTH0C07942g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MSSEANPPVLEPFTVTVVDRNVKHQVEGEPEEEGHPDHEVQGVMFATNVKYIFEDDQELLPEQEDPAIENVVIIEADESLRVTQVELISDQFKQVGYEVRDGNEVCIDALSRFETPRQLGNLPLEKLVQLYKLQNDQLHSLFNTL c5df24_lactc Autophagy-related protein 29 KLTH0D11660g protein protein lactc Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) Yeast Kluyveromyces thermotolerans MNSENTIVYVRVAGRARNGFVDPLKFYWDLERDRSLWSSVSKLDNTKKTIDWKRLSREFKAPEHFIRKRSYALFAKHLKLLERQIEAKTRSLAVTEDELNYTDEDDERNSISHGEDDFEAAEGLKNLRTSKVLKQRVPGEGRNGESSLSELSNLSVSKSALEEALLDRLQL atg31_yeast Autophagy-related protein 31 ATG31 CIK1 suppressor protein 1 CIS1 Protein CIS1 PZD196 YD9335.08c YDR022C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVTVTVYDKNVKYRLEENIKNNKGPSNDDQPAYNNESKSTDGSDYAMFPTNIKYIFEDNNDELVDSSDAALTAGIDKVGDELENVIIVQLDESGSLEDITLISDQYELLSHRTNSLSLEENQMRTLSSHGDDKSNDEEEELSVDSDRFRVDSDIELDVISQFCDLSPFLRDLSLNDLIKLYVTQNEQLQMLSNSV CC2396854F29D250 atg29_yeast Autophagy-related protein 29 P2540 YPL166W ATG29 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIMNSTNTVVYIKVKGRRPQGFLDPPKFEWNGTKERQLWTMVSNLNYSQDQIDWQNLSKIFETPEFFLKKRTYKLFAEHLELLQLQLEKKRDLEKYSNDQVNEGMSDLIHKYTPTLQNDNLLNVSASPLTTERQDSEEVETEVTNEALQHLQTSKILNIHKKTSDSENKPNDKLDKDGINKEMECGSSDDDLSSSLSVSKSALEEALMDRLQF E620EF94CF662BD4 atg17_yeast Autophagy-related protein 17 ATG17 APG17 YLR423C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNEADVTKFVNNARKTLTDAQLLCSSANLRIVDIKKKLSSWQLSISKLNFLIVGLRQQGKFLYTILKEGIGTKLIQKQWNQAVLVVLVDEMKYWQYEITSKVQRLDGIVNELSISEKDDTDPSKLGDYISRDNVNLLNDKLKEVPVIERQIENIKLQYENMVRKVNKELIDTKLTDVTQKFQSKFGIDNLMETNVAEQFSRELTDLEKDLAEIMNSLTQHFDKTLLLQDKKIDNDEREELFKVVQGDDKELYNIFKTLHEVIDDVDKTILNLGQFLQAKIKEKTELHSEVSEIINDFNRNLEYLLIFKDISNLIDSFKNSCTQDIQTTKELCEFYDNFEESYGNLVLEAKRRKDVANRMKTILKDCEKQLQNLDAQDQEERQNFIAENGTYLPETIWPGKIDDFSSLYTLNYNVKNP 71504B6C76549B75 c5deb9-c5df24-3 1374407 n/a 1374411 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli n/a 1374412 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli n/a 1374413 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association false false false Fig. 2I 3.06A Rwork = 0.3 Rfree = 0.34 c5deb9-c5df24-4 1374407 n/a 1374413 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli n/a 1374412 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false Fig. 2I 3.06A Rwork = 0.3 Rfree = 0.34 atg17-atg29-1 1374407 n/a 1374414 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1374415 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1374416 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 4E c5deb9-c5df24-1 1374408 n/a 1374412 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli Stoichiometry: 2.0 n/a 1374411 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli Stoichiometry: 2.0 n/a 1374413 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli Stoichiometry: 2.0 physical association physical association false false false Fig. 3A atg17-atg29-2 1374408 n/a 1374415 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1374414 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1374416 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 4D c5deb9-c5df24 1374409 n/a 1374411 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli Stoichiometry: 2.0 n/a 1374412 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli Stoichiometry: 2.0 n/a 1374413 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli Stoichiometry: 2.0 physical association physical association false false false Supp. Table 1 3.06A Rwork = 0.3 Rfree = 0.34 c5deb9-c5df24-2 1374410 n/a 1374413 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli n/a 1374411 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli n/a 1374412 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false 3c, suppl. table 3 3.06A Rwork = 0.3 Rfree = 0.34