IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ itakura-2012-2 The hairpin-type tail-anchored SNARE syntaxin 17 targets to autophagosomes for fusion with endosomes/lysosomes. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Itakura E., Kishi-Itakura C., Mizushima N. nmizu@m.u-tokyo.ac.jp Cell (0092-8674) 2012 Only protein-protein interactions imex curation itakura-2012-1 The hairpin-type tail-anchored SNARE syntaxin 17 targets to autophagosomes for fusion with endosomes/lysosomes. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Itakura E., Kishi-Itakura C., Mizushima N. nmizu@m.u-tokyo.ac.jp Cell (0092-8674) 2012 Only protein-protein interactions imex curation itakura-2012-3 The hairpin-type tail-anchored SNARE syntaxin 17 targets to autophagosomes for fusion with endosomes/lysosomes. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Itakura E., Kishi-Itakura C., Mizushima N. nmizu@m.u-tokyo.ac.jp Cell (0092-8674) 2012 Only protein-protein interactions imex curation itakura-2012-4 The hairpin-type tail-anchored SNARE syntaxin 17 targets to autophagosomes for fusion with endosomes/lysosomes. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Itakura E., Kishi-Itakura C., Mizushima N. Colocalisations only describing subcellular locations of proteins have not been annotated. nmizu@m.u-tokyo.ac.jp Cell (0092-8674) 2012 Only protein-protein interactions imex curation stx17_human Syntaxin-17 STX17 protein protein human Homo sapiens Human MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYKLAALPVAGALIGGMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQKMMEKLTSSCPDLPSQTDKKCS vamp8_human Vesicle-associated membrane protein 8 Endobrevin VAMP8 protein protein human Homo sapiens Human MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS vti1b_human Vesicle transport through interaction with t-SNAREs homolog 1B Vesicle transport v-SNARE protein Vti1-like 1 Vti1-rp1 VTI1B VTI1 VTI1L VTI1L1 VTI2 protein protein human Homo sapiens Human MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELAILGGLVYYKFFRSH snp29_human Synaptosomal-associated protein 29 Vesicle-membrane fusion protein SNAP-29 Soluble 29 kDa NSF attachment protein SNAP29 protein protein human Homo sapiens Human MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL vamp7_mouse Vesicle-associated membrane protein 7 Vamp7 Sybl1 Synaptobrevin-like protein 1 protein protein mouse Mus musculus Mouse MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKSLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNIKLTIIIIIVSIVFIYIIVSLLCGGFTWPNCVKK stx17_mouse Syntaxin-17 Stx17 protein protein mouse Mus musculus Mouse MSEDEEKVKLRRLEPAIQKFTKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREMEKLCLKVHKDDLVLLKRMIDPVKEAAATATAEFLQLHLESVEELKKQVNDEELLQPSLTRSTTVDGVLHTGEAEAASQSLTQIYALPEIPQDQNAAESWETLEADLIELSHLVTDMSLLVSSQQEKIDSIADHVNSAAVNVEEGTKNLQKAAKYKLAALPVAGALIGGVVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRRKQKMMEKLTSSCPDLPSQSDKKRS vamp8_mouse Vesicle-associated membrane protein 8 Vamp8 Endobrevin protein protein mouse Mus musculus Mouse MEEASGSAGNDRVRNLQSEVEGVKNIMTQNVERILSRGENLDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIIVILIILFATGTIPT snp29_mouse Synaptosomal-associated protein 29 Snap29 Golgi SNARE of 32 kDa Soluble 29 kDa NSF attachment protein Vesicle-membrane fusion protein SNAP-29 protein protein mouse Mus musculus Mouse MSGYPKSYNPFDDDVEEEDTRPAPWKDVRDLPDGPDAPIDRQQYLRQEVLRRAEATAASTSRSLSLMYESEKIGVASSEELVRQRGVLEHTEKMVDKMDQDLKMSQKHINSIKSVFGGFINYFKSKPVEPPPEQNGSIVSQPNSRLKEAINTSKDQENKYQASHPNLRRLQDAELDSVPKEPSSTVNTEVYPKNSTLRTYHQKIDSNLDELSVGLGHLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKKVRQL vti1b-stx17 1372910 n/a 1372914 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind range range range range false n/a 1372915 unspecified role unspecified role prey prey n/a 1372916 unspecified role unspecified role bait bait association association false false false Supp Fig. 2A snap29-stx17-1 1372910 n/a 1372914 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372917 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372915 unspecified role unspecified role prey prey association association false false false Fig. 3D stx17-vamp8 1372910 n/a 1372914 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372915 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3B, Supp. Fig. 2A stx17-snap29-1 1372910 n/a 1372915 unspecified role unspecified role prey prey n/a 1372914 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind range range range range false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372917 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3D stx17-vamp8-2 1372910 n/a 1372915 unspecified role unspecified role prey prey n/a 1372914 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372916 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 2A vamp8-stx17-1 1372910 n/a 1372915 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372914 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3A vamp8-snap29 1372910 n/a 1372914 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372915 unspecified role unspecified role bait bait n/a 1372917 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3E Overexpression of SNAP-29 enhanced the interaction between Stx17 and VAMP8 stx17-snap29-4 1372910 n/a 1372915 unspecified role unspecified role prey prey n/a 1372914 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind range range range range false n/a 1372917 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3D, Supp Fig. 2A snap29-stx17-4 1372910 n/a 1372915 unspecified role unspecified role prey prey n/a 1372914 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372917 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3D, Supp Fig. 2A stx17-vamp8-3 1372911 n/a 1372915 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372914 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 2A vamp7-stx17 1372911 n/a 1372914 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372918 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 2A vamp8-stx17 1372911 n/a 1372914 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372915 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 2A stx17-vamp7 1372911 n/a 1372918 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372914 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 2A stx17-vamp8-1 1372912 n/a 1372919 unspecified role unspecified role bait bait n/a 1372920 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3C Starvation stx17-snap29-3 1372912 n/a 1372921 unspecified role unspecified role prey prey n/a 1372919 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3F Starvation snap29-stx17-3 1372913 n/a 1372914 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372917 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 3I Starvation