IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sebasti_n-2012-5 The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation sebasti_n-2012-6 The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. human-h1 H1 Human ES cell line h1 H1 Human ES cell line ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation sebasti_n-2012-7 The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation sebasti_n-2012-3 The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation sebasti_n-2012-1 The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation sebasti_n-2012-2 The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation sebasti_n-2012-4 The histone deacetylase SIRT6 is a tumor suppressor that controls cancer metabolism. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sebastián C., Zwaans B.M., Silberman D.M., Gymrek M., Goren A., Zhong L., Ram O., Truelove J., Guimaraes A.R., Toiber D., Cosentino C., Greenson J.K., MacDonald A.I., McGlynn L., Maxwell F., Edwards J., Giacosa S., Guccione E., Weissleder R., Bernstein B.E., Regev A., Shiels P.G., Lombard D.B., Mostoslavsky R. Cancer - Interactions investigated in the context of cancer Source of Flag tagged Sirt6 and c-myc taken from previous work of the author (PMID: 23142079 and 20592034 respectively) rmostoslavsky@mgh.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation sir6_human NAD-dependent protein deacetylase sirtuin-6 SIR2-like protein 6 SIRT6 SIR2L6 Regulatory protein SIR2 homolog 6 protein protein human Homo sapiens Human MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS rl3_human_gene 60S ribosomal protein L3 gene gene gene human Homo sapiens Human myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA rl6_huma_gene 60S ribosomal protein L6 gene gene gene human Homo sapiens Human rl23_human_gene 60S ribosomal protein L23 gene gene gene human Homo sapiens Human rs15a_human_gene 40S ribosomal protein S15a gene gene gene human Homo sapiens Human myc_mouse Myc proto-oncogene protein Proto-oncogene c-Myc Transcription factor p64 Myc protein protein mouse Mus musculus Mouse MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA rl3_mouse_gene 60S ribosomal protein L3 genr gene gene mouse Mus musculus Mouse rl6_mouse_gene 60S ribosomal protein L6 gene gene gene mouse Mus musculus Mouse rl23_mouse_gene 60S ribosomal protein L23 gene gene gene mouse Mus musculus Mouse rs15a_mouse_gene 40S ribosomal protein S15a gene gene mouse Mus musculus Mouse sir2_human NAD-dependent protein deacetylase sirtuin-2 SIR2-like protein 2 SIRT2 SIR2L SIR2L2 Regulatory protein SIR2 homolog 2 protein protein human Homo sapiens Human MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPAKDEARTTEREKPQ sir5_human NAD-dependent protein deacylase sirtuin-5, mitochondrial SIRT5 SIR2L5 Regulatory protein SIR2 homolog 5 SIR2-like protein 5 protein protein human Homo sapiens Human MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS sir6_mouse NAD-dependent protein deacetylase sirtuin-6 Sirt6 Sir2l6 SIR2-like protein 6 Regulatory protein SIR2 homolog 6 protein protein mouse Mus musculus Mouse MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLMWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECPKCKTQYVRDTVVGTMGLKATGRLCTVAKTRGLRACRGELRDTILDWEDSLPDRDLMLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS sirt6-rl3 1372423 n/a 1372430 unspecified role unspecified role bait bait n/a 1372431 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4D SIRT6 binding extended into the intragenic regions. myc-rl3 1372423 n/a 1372431 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372432 unspecified role unspecified role bait bait association association false false false Fig. 4D myc-rl6 1372423 n/a 1372433 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372432 unspecified role unspecified role bait bait association association false false false Fig. 4D sirt6-rl6 1372423 n/a 1372430 unspecified role unspecified role bait bait n/a 1372433 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4D SIRT6 binding extended into the intragenic regions. myc-rl23 1372423 n/a 1372434 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372432 unspecified role unspecified role bait bait association association false false false Fig. 4D sirt6-rl23 1372423 n/a 1372430 unspecified role unspecified role bait bait n/a 1372434 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4D SIRT6 binding extended into the intragenic regions. myc-rs15a 1372423 n/a 1372435 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372432 unspecified role unspecified role bait bait association association false false false Fig. 4D sirt6-rs15a 1372423 n/a 1372435 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372430 unspecified role unspecified role bait bait association association false false false Fig. 4D SIRT6 binding extended into the intragenic regions. sirt6-rl23-1 1372424 n/a 1372434 unspecified role unspecified role prey prey n/a 1372430 unspecified role unspecified role bait bait association association false false false Fig. 4D SIRT6 binding extended into the intragenic regions. sirt6-rs15a-1 1372424 n/a 1372430 unspecified role unspecified role bait bait n/a 1372435 unspecified role unspecified role prey prey association association false false false Fig. 4D SIRT6 binding extended into the intragenic regions. sirt6-rl3-1 1372424 n/a 1372430 unspecified role unspecified role bait bait n/a 1372431 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4D SIRT6 binding extended into the intragenic regions. sirt6-rl6-1 1372424 n/a 1372433 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372430 unspecified role unspecified role bait bait association association false false false Fig. 4D SIRT6 binding extended into the intragenic regions. myc-rl3-2 1372425 n/a 1372436 unspecified role unspecified role bait bait n/a 1372437 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5D myc-rl6-1 1372425 n/a 1372436 unspecified role unspecified role bait bait n/a 1372438 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5D myc-rl23-1 1372425 n/a 1372439 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372436 unspecified role unspecified role bait bait association association false false false Supp. Fig. 5D myc-rs15a-1 1372425 n/a 1372436 unspecified role unspecified role bait bait n/a 1372440 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5D sirt6-myc 1372426 n/a 1372430 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372432 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 4C sirt2-myc 1372426 n/a 1372432 unspecified role unspecified role prey prey n/a 1372441 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 4C sirt5-myc 1372426 n/a 1372442 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372432 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 4C sirt6-myc 1372427 n/a 1372430 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372432 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4E myc-sirt6-1 1372428 n/a 1372432 unspecified role unspecified role bait bait n/a 1372430 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4E sirt6-myc-2 1372429 n/a 1372436 unspecified role unspecified role prey prey n/a 1372443 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4F