InnateDB InnateDB lin-2013-1 ARIH2 is essential for embryogenesis, and its hematopoietic deficiency causes lethal activation of the immune system. mouse-dendritic cell Mouse dendritic cell dendritic_cell dendritic cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lin A.E., Ebert G., Ow Y., Preston S.P., Toe J.G., Cooney J.P., Scott H.W., Sasaki M., Saibil S.D., Dissanayake D., Kim R.H., Wakeham A., You-Ten A., Shahinian A., Duncan G., Silvester J., Ohashi P.S., Mak T.W., Pellegrini M. Fetal liver–derived DCs. pellegrini@wehi.edu.au Nat. Immunol. (1529-2908) 2013 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity lin-2013-2 ARIH2 is essential for embryogenesis, and its hematopoietic deficiency causes lethal activation of the immune system. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lin A.E., Ebert G., Ow Y., Preston S.P., Toe J.G., Cooney J.P., Scott H.W., Sasaki M., Saibil S.D., Dissanayake D., Kim R.H., Wakeham A., You-Ten A., Shahinian A., Duncan G., Silvester J., Ohashi P.S., Mak T.W., Pellegrini M. Ikbb PEST domain:-The reference given (no 34-McKinsey et al.) appears to refer to a Human protein,however, the sequence given (PCSSSSDSDGG) does not correspond to any protein in UniProt with 100% identity. Fetal liver–derived DCs. The authors have supplied construct origins. pellegrini@wehi.edu.au Nat. Immunol. (1529-2908) 2013 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity ari2_mouse E3 ubiquitin-protein ligase ARIH2 Arih2 Ari2 Triad1 Uip48 Triad1 protein UbcM4-interacting protein 48 RING-type E3 ubiquitin transferase ARIH2 protein protein mouse Mus musculus Mouse MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALHEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYRSNSAQLLVEARVQPNPSKHVPTAHPPHHCAVCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGISCMAQDCPLRTPEDFVFPLLPNEELRDKYRRYLFRDYVESHFQLQLCPGADCPMVIRVQEPRARRVQCNRCSEVFCFKCRQMYHAPTDCATIRKWLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIVNQSQQAQAREALKKYLFYFERWENHNKSLQLEAQTYERIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKDFHDT ikbb_mouse NF-kappa-B inhibitor beta I-kappa-B-beta Nfkbib Ikbb protein protein mouse Mus musculus Mouse MAGVACLGKTADADEWCDSGLGSLGPDAAAPGGPGLGAELGPELSWAPLVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAPEPEDEDDKLSPCSSSGSDSDSDNRDEGDEYDDIVVHSGRSQNRQPPSPASKPLPDDPNPA arih2-nfkbib 1420651 n/a 1420653 unspecified role unspecified role prey prey n/a 1420654 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6C MG132 (proteasomal inhibitor), LPS nfkbib-arih2 1420652 n/a 1420654 unspecified role unspecified role bait bait c_terminal_pest_domain required to bind necessary binding region required to bind certain certain sequence position certain undetermined undetermined sequence position undetermined false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1420653 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6D MG132 (proteasomal inhibitor)