IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ manavella-2012-1 Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. nicbe-leaf Nicotiana benthamiana leaf leaf leaf confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Cell (0092-8674) 2012 Only protein-protein interactions imex curation manavella-2012-6 Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Cell (0092-8674) 2012 Only protein-protein interactions imex curation manavella-2012-3 Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. arath-leaf Arabidopsis thaliana leaf leaf leaf anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. Presence of CPL1 confirmed by anti-tag western. weigel@weigelworld.org Cell (0092-8674) 2012 Only protein-protein interactions imex curation manavella-2012-4 Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. nicbe-leaf Nicotiana benthamiana leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Cell (0092-8674) 2012 Only protein-protein interactions imex curation manavella-2012-7 Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Cell (0092-8674) 2012 Only protein-protein interactions imex curation manavella-2012-2 Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. arath-leaf Arabidopsis thaliana leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Cell (0092-8674) 2012 Only protein-protein interactions imex curation manavella-2012-5 Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. nicbe-leaf Nicotiana benthamiana leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Cell (0092-8674) 2012 Only protein-protein interactions imex curation manavella-2012-8 Fast-forward genetics identifies plant CPL phosphatases as regulators of miRNA processing factor HYL1. arath-leaf Arabidopsis thaliana leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Manavella P.A., Hagmann J., Ott F., Laubinger S., Franz M., Macek B., Weigel D. weigel@weigelworld.org Cell (0092-8674) 2012 Only protein-protein interactions imex curation dcl1_arath Endoribonuclease Dicer homolog 1 Protein CARPEL FACTORY Protein SHORT INTEGUMENTS 1 Protein SUSPENSOR 1 DCL1 ASU1 SUS1 At1g01040 T25K16.4 CAF SIN1 Dicer-like protein 1 Protein ABNORMAL SUSPENSOR 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVMEDEPREATIKPSYWLDACEDISCDLIDDLVSEFDPSSVAVNESTDENGVINDFFGGIDHILDSIKNGGGLPNNGVSDTNSQINEVTVTPQVIAKETVKENGLQKNGGKRDEFSKEEGDKDRKRARVCSYQSERSNLSGRGHVNNSREGDRFMNRKRTRNWDEAGNNKKKRECNNYRRDGRDREVRGYWERDKVGSNELVYRSGTWEADHERDVKKVSGGNRECDVKAEENKSKPEERKEKVVEEQARRYQLDVLEQAKAKNTIAFLETGAGKTLIAILLIKSVHKDLMSQNRKMLSVFLVPKVPLVYQQAEVIRNQTCFQVGHYCGEMGQDFWDSRRWQREFESKQVLVMTAQILLNILRHSIIRMETIDLLILDECHHAVKKHPYSLVMSEFYHTTPKDKRPAIFGMTASPVNLKGVSSQVDCAIKIRNLETKLDSTVCTIKDRKELEKHVPMPSEIVVEYDKAATMWSLHETIKQMIAAVEEAAQASSRKSKWQFMGARDAGAKDELRQVYGVSERTESDGAANLIHKLRAINYTLAELGQWCAYKVGQSFLSALQSDERVNFQVDVKFQESYLSEVVSLLQCELLEGAAAEKVAAEVGKPENGNAHDEMEEGELPDDPVVSGGEHVDEVIGAAVADGKVTPKVQSLIKLLLKYQHTADFRAIVFVERVVAALVLPKVFAELPSLSFIRCASMIGHNNSQEMKSSQMQDTISKFRDGHVTLLVATSVAEEGLDIRQCNVVMRFDLAKTVLAYIQSRGRARKPGSDYILMVERGNVSHAAFLRNARNSEETLRKEAIERTDLSHLKDTSRLISIDAVPGTVYKVEATGAMVSLNSAVGLVHFYCSQLPGDRYAILRPEFSMEKHEKPGGHTEYSCRLQLPCNAPFEILEGPVCSSMRLAQQAVCLAACKKLHEMGAFTDMLLPDKGSGQDAEKADQDDEGEPVPGTARHREFYPEGVADVLKGEWVSSGKEVCESSKLFHLYMYNVRCVDFGSSKDPFLSEVSEFAILFGNELDAEVLSMSMDLYVARAMITKASLAFKGSLDITENQLSSLKKFHVRLMSIVLDVDVEPSTTPWDPAKAYLFVPVTDNTSMEPIKGINWELVEKITKTTAWDNPLQRARPDVYLGTNERTLGGDRREYGFGKLRHNIVFGQKSHPTYGIRGAVASFDVVRASGLLPVRDAFEKEVEEDLSKGKLMMADGCMVAEDLIGKIVTAAHSGKRFYVDSICYDMSAETSFPRKEGYLGPLEYNTYADYYKQKYGVDLNCKQQPLIKGRGVSYCKNLLSPRFEQSGESETVLDKTYYVFLPPELCVVHPLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASCQETFCYERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYIQADRFAPSRWSAPGVPPVFDEDTKDGGSSFFDEEQKPVSEENSDVFEDGEMEDGELEGDLSSYRVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVLKSIDFVGLERALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQAEGLEYKASRSGNTATVEVFIDGVQVGVAQNPQKKMAQKLAARNALAALKEKEIAESKEKHINNGNAGEDQGENENGNKKNGHQPFTRQTLNDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKTFS cpl1_arath RNA polymerase II C-terminal domain phosphatase-like 1 CPL1 FRY2 JOE1 Carboxyl-terminal phosphatase-like 1 Protein JASMONATE OVEREXPRESSING 1 Protein FIERY 2 Protein SHINY 4 SHI4 F17L22.130 At4g21670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYSNNRVEVFHGDGRLGELEIYPSRELNQQQDDVMKQRKKKQREVMELAKMGIRISHFSQSGERCPPLAILTTISSCGLCFKLEASPSPAQESLSLFYSSCLRDNKTAVMLLGGEELHLVAMYSENIKNDRPCFWAFSVAPGIYDSCLVMLNLRCLGIVFDLDETLVVANTMRSFEDKIDGFQRRINNEMDPQRLAVIVAEMKRYQDDKNLLKQYIESDQVVENGEVIKVQSEIVPALSDNHQPLVRPLIRLQEKNIILTRINPMIRDTSVLVRMRPSWEELRSYLTAKGRKRFEVYVCTMAERDYALEMWRLLDPEGNLINTNDLLARIVCVKSGFKKSLFNVFLDGTCHPKMALVIDDRLKVWDEKDQPRVHVVPAFAPYYSPQAEAAATPVLCVARNVACGVRGGFFRDFDDSLLPRIAEISYENDAEDIPSPPDVSHYLVSEDDTSGLNGNKDPLSFDGMADTEVERRLKEAISASSAVLPAANIDPRIAAPVQFPMASASSVSVPVPVQVVQQAIQPSAMAFPSIPFQQPQQPTSIAKHLVPSEPSLQSSPAREEGEVPESELDPDTRRRLLILQHGQDTRDPAPSEPSFPQRPPVQAPPSHVQSRNGWFPVEEEMDPAQIRRAVSKEYPLDSEMIHMEKHRPRHPSFFSKIDNSTQSDRMLHENRRPPKESLRRDEQLRSNNNLPDSHPFYGEDASWNQSSSRNSDLDFLPERSVSATETSADVLHGIAIKCGAKVEYKPSLVSSTDLRFSVEAWLSNQKIGEGIGKSRREALHKAAEASIQNLADGYMRANGDPGPSHRDATPFTNENISMGNANALNNQPFARDETALPVSSRPTDPRLEGSMRHTGSITALRELCASEGLEMAFQSQRQLPSDMVHRDELHAQVEIDGRVVGEGVGSTWDEARMQAAERALSSVRSMLGQPLHKRQGSPRSFGGMSNKRLKPDFQRSLQRMPSSGRYS srrt_arath Serrate RNA effector molecule SE T20P8.15 At2g27100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADVNLPPSDSVDNRLPEKSTSSSPPPPPPSSSLPQQEQEQDQQQLPLRRERDSRERRDERDIERPPPNRRERDRSPLPPPRRDYKRRPSLSPPPPYRDRRHSPPQRRSPPQKRYRRDDNGYDGRRGSPRGGYGPPDRRFGYDHGGGYDREMGGRPGYGDERPHGRFMGRYQDWEGGRGGYGDASNSGNPQRDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAFFNTHKEEDWLKNKYHPTNLLSVIERRNDLAQKVAKDFLLDLQSGTLDLGPAVTALNKSGRTSEPNSEDEAAGVGKRKRHGMGGAKENELLSAAPKAPSFTSDPKRILTDVEQTQALVRKLDSEKKIEENVLQGSETEKSGREKLHSGSTGPVVIIRGLTSVKGLEGVELLDTLVTYLWRVHGLDYYGKVETNEAKGLRHVRAEGKVSDAKGDENESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYFQNYMNDPNAPGGQPATQQSGPRDRPIRRKPSMENRLRDDRGGRRERDGRANGNDRNDRSEDQQRGDNDGGNPGEVGYDAFGGQGGVHVPPFLSDINPPPMLMPVPGAGPLGPFVPAPPEVAMQMFRDPSGPNPPFEGSGRGGPAPFLLSPAFRQDPRRLRSYQDLDAPEEEVTVIDYRSL drb1_arath Double-stranded RNA-binding protein 1 F21M12.9 At1g09700 DRB1 HYL1 Protein HYPONASTIC LEAVES 1 dsRNA-binding protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSTDVSSGVSNCYVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAKSSELSQCVSQPVHETGLCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISAGRTALLAIQSDTKNNLANYNTQLTVLPCEKKTIQAAIPLKETVKTLKARKAQFKKKAQKGKRTVAKNPEDIIIPPQPTDHCQNDQSEKIETTPNLEPSSCMNGLKEAAFGSVETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLEPSSCMNGLKEAAFGSVETEKIETTPNLEPPSCMNGLKEAAFGSVETEKIETTPNLESSSCMSGLKEAAFGSVETEASHA cpl1-dcl1 1372084 n/a 1372092 unspecified role unspecified role neutral component neutral component n-terminal mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1372093 unspecified role unspecified role neutral component neutral component c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 3A, Supp. Fig. 3B, 3C cpl1-se 1372084 n/a 1372094 unspecified role unspecified role neutral component neutral component c-terminal mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1372093 unspecified role unspecified role neutral component neutral component c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 3A, Supp. Fig. 3B, 3C cpl1-drb1 1372084 n/a 1372093 unspecified role unspecified role neutral component neutral component c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1372095 unspecified role unspecified role neutral component neutral component c-terminal mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 3A, Supp. Fig. 3B, 3C cpl1-se-2 1372085 n/a 1372094 unspecified role unspecified role prey prey n/a 1372093 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4A se-drb1 1372085 n/a 1372094 unspecified role unspecified role bait bait n/a 1372095 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4A cpl1-se-3 1372085 n/a 1372093 unspecified role unspecified role bait bait n/a 1372094 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 4 drb1-cpl1 1372086 n/a 1372093 unspecified role unspecified role prey prey c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1372095 unspecified role unspecified role bait bait n/a 1372094 unspecified role unspecified role prey prey association association false false false Fig. 3C se-cpl1 1372086 n/a 1372095 unspecified role unspecified role prey prey n/a 1372093 unspecified role unspecified role prey prey c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1372094 unspecified role unspecified role bait bait association association false false false Fig. 3C cpl1-se-1 1372087 n/a 1372094 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372093 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3D drb1-se 1372087 n/a 1372095 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372094 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3D cpl1-drb1-5 1372088 n/a 1372093 unspecified role unspecified role bait bait n/a 1372095 unspecified role unspecified role prey prey n/a 1372094 unspecified role unspecified role ancillary ancillary physical association physical association false false false Fig. 4B drb1-cpl1-1 1372088 n/a 1372093 unspecified role unspecified role prey prey n/a 1372095 unspecified role unspecified role bait bait n/a 1372094 unspecified role unspecified role ancillary ancillary physical association physical association false false false Fig. 4B cpl1-drb1-2 1372089 n/a 1372094 unspecified role unspecified role prey prey n/a 1372095 unspecified role unspecified role prey prey n/a 1372093 unspecified role unspecified role bait bait c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Fig. 3C cpl1-drb1-3 1372090 n/a 1372093 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1372095 unspecified role unspecified role neutral component neutral component region cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 3D cpl1-drb1-6 1372091 n/a 1372093 unspecified role unspecified role bait bait c-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1372095 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5A The hypophosphorylated form of HYL1 is enriched in the immunoprecipitate.