InnateDB InnateDB ring-2012-2 Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Ring A.M., Lin J.X., Feng D., Mitra S., Rickert M., Bowman G.R., Pande V.S., Li P., Moraga I., Spolski R., Ozkan E., Leonard W.J., Garcia K.C. kcgarcia@stanford.edu Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity ring-2012-1 Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ring A.M., Lin J.X., Feng D., Mitra S., Rickert M., Bowman G.R., Pande V.S., Li P., Moraga I., Spolski R., Ozkan E., Leonard W.J., Garcia K.C. kcgarcia@stanford.edu Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity ring-2012-3 Mechanistic and structural insight into the functional dichotomy between IL-2 and IL-15. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Ring A.M., Lin J.X., Feng D., Mitra S., Rickert M., Bowman G.R., Pande V.S., Li P., Moraga I., Spolski R., Ozkan E., Leonard W.J., Garcia K.C. kcgarcia@stanford.edu Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity il2rb_human Interleukin-2 receptor subunit beta IL2RB High affinity IL-2 receptor subunit beta p70-75 Interleukin-15 receptor subunit beta IL15RB protein protein human Homo sapiens Human MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQELQGQDPTHLV il15_human Interleukin-15 IL15 protein protein human Homo sapiens Human MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS i15ra_human Interleukin-15 receptor subunit alpha IL15RA protein protein human Homo sapiens Human MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL il2rg_human Cytokine receptor common subunit gamma IL2RG p64 gammaC Interleukin-2 receptor subunit gamma protein protein human Homo sapiens Human MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET il2rb-il15-3 1419904 n/a 1419907 unspecified role unspecified role bait bait purified purified biotinylated bap tag biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1419908 unspecified role unspecified role prey prey purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction false false false 1419904 Fig. 4A il2rb-il15-1 1419904 n/a 1419907 unspecified role unspecified role bait bait biotinylated bap tag biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1419908 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. n/a 1419909 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false 1419904 Fig. 4A il15-il15ra-3 1419905 n/a 1419910 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P31785:p.Ser53Asp mutation mutation certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 1.0 n/a 1419907 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P14784:p.[Ala3Asp;Leu17Asp;Ser45Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 1.0 n/a 1419909 unspecified role unspecified role neutral component neutral component region his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1419908 unspecified role unspecified role neutral component neutral component c-terminal his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Table 1, Fig. 1. 2.35A Rwork = 19.2 Rfree = 24.2 il15-il15ra-4 1419906 n/a 1419910 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P31785:p.Ser53Asp mutation mutation certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 1.0 n/a 1419908 unspecified role unspecified role neutral component neutral component c-terminal his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1419909 unspecified role unspecified role neutral component neutral component c-terminal his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1419907 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P14784:p.[Ala3Asp;Leu17Asp;Ser45Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 1.0 physical association physical association false false false Fig. S1A