IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wuttge-2012-3 Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. The ATPase assays were conducted in proteoliposomes constructed from the UgpAEC or MalFG-UgpC complex and total E. coli phospholipids in detergent and subsequent removal of the detergent by adsorption to hydrophobic beads. UgpB/G3P and MalE/maltose, respectively, were either added prior to proteoliposome formation and enclosed into its lumen or added afterwards to the medium. In the latter case, Mg2+ ions were added to the medium to permealise the proteoliposomes and allow ATP access to the lumen. ATPase activity was initiated by the addition of ATP (in some cases [gamma-32P]ATP) and measured by assaying the release of inorganic phosphate. erwin.schneider@rz.hu-berlin.de Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation wuttge-2012-4 Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. emailed author as origin of malfgk complex not clear. erwin.schneider@rz.hu-berlin.de Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation wuttge-2012-1 Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. erwin.schneider@rz.hu-berlin.de Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation wuttge-2012-5 Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. in vitro In vitro atpase assay atpase assay autoradiography autoradiography Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. The ATPase assays were conducted in proteoliposomes constructed from the UgpAEC or MalFG-UgpC complex and total E. coli phospholipids in detergent and subsequent removal of the detergent by adsorption to hydrophobic beads. UgpB/G3P and MalE/maltose, respectively, were either added prior to proteoliposome formation and enclosed into its lumen or added afterwards to the medium. In the latter case, Mg2+ ions were added to the medium to permealise the proteoliposomes and allow ATP access to the lumen. ATPase activity was initiated by the addition of ATP (in some cases [gamma-32P]ATP) and measured by assaying the release of inorganic phosphate. erwin.schneider@rz.hu-berlin.de Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation wuttge-2012-2 Determinants of substrate specificity and biochemical properties of the sn-glycerol-3-phosphate ATP binding cassette transporter (UgpB-AEC2 ) of Escherichia coli. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wuttge S., Bommer M., Jäger F., Martins B.M., Jacob S., Licht A., Scheffel F., Dobbek H., Schneider E. erwin.schneider@rz.hu-berlin.de Mol. Microbiol. (0950-382X) 2012 Only protein-protein interactions imex curation atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sn-glycerol 3-phosphate sn-glycerol 3-phosphate (R)-glycerol 1-phosphate D-(glycerol 1-phosphate) Glycerol-3-phosphate Glycerophosphoric acid L-(glycerol 3-phosphate) phosphoric acid mono-((R)-2,3-dihydroxy-propyl) ester Phosphorsaeure-mono-((R)-2,3-dihydroxy-propylester) sn-Glycerol 3-phosphate SN-GLYCEROL-3-PHOSPHATE sn-Gro-1-P (2R)-2,3-dihydroxypropyl dihydrogen phosphate sn-glycerol 3-(dihydrogen phosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) AWUCVROLDVIAJX-GSVOUGTGSA-N ugpb_ecoli sn-glycerol-3-phosphate-binding periplasmic protein UgpB ugpB b3453 JW3418 protein protein ecoli Escherichia coli (strain K12) MKPLHYTASALALGLALMGNAQAVTTIPFWHSMEGELGKEVDSLAQRFNAENPDYKIVPTYKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVYDVFKEAGIQFDESQFVPTVSGYYSDSKTGHLLSQPFNSSTPVLYYNKDAFKKAGLDPEQPPKTWQDLADYAAKLKASGMKCGYASGWQGWIQLENFSAWNGLPFASKNNGFDGTDAVLEFNKPEQVKHIAMLEEMNKKGDFSYVGRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMPYDADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFYEKNPGADTATRQMLNKPPLPFTKGLRLGNMPQIRVIVDEELESVWTGKKTPQQALDTAVERGNQLLRRFEKSTKS E0B9B5885B240C8D ugpc_ecoli sn-glycerol-3-phosphate import ATP-binding protein UgpC ugpC b3450 JW3415 protein protein ecoli Escherichia coli (strain K12) MAGLKLQAVTKSWDGKTQVIKPLTLDVADGEFIVMVGPSGCGKSTLLRMVAGLERVTEGDIWINDQRVTEMEPKDRGIAMVFQNYALYPHMSVEENMAWGLKIRGMGKQQIAERVKEAARILELDGLLKRRPRELSGGQRQRVAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVMVMNGGVAEQIGTPVEVYEKPASLFVASFIGSPAMNLLTGRVNNEGTHFELDGGIELPLNGGYRQYAGRKMTLGIRPEHIALSSQAEGGVPMVMDTLEILGADNLAHGRWGEQKLVVRLAHQERPTAGSTLWLHLAENQLHLFDGETGQRV ugpe_ecoli sn-glycerol-3-phosphate transport system permease protein UgpE ugpE b3451 JW3416 protein protein ecoli Escherichia coli (strain K12) MIENRPWLTIFSHTMLILGIAVILFPLYVAFVAATLDKQAVYAAPMTLIPGTHLLENIHNIWVNGVGTNSAPFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFITLMLPVEVRIFPTVEVIANLQMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIATGEGTTEWNSVMVAMLLTLIPPVVIVLVMQRAFVRGLVDSEK ugpa_ecoli sn-glycerol-3-phosphate transport system permease protein UgpA ugpA b3452 JW3417 protein protein ecoli Escherichia coli (strain K12) MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFVTLFHDSYYLDSFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPAVAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSGGPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVESKVRYQ vanadium oxoanion vanadium oxoanion Vanadate vanadium oxoanion vanadium oxoanions small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) maltose Maltose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) male_ecoli Maltose/maltodextrin-binding periplasmic protein malE MMBP Maltodextrin-binding protein Maltose-binding protein JW3994 b4034 protein protein ecoli Escherichia coli (strain K12) MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK malf_ecoli Maltose/maltodextrin transport system permease protein MalF malF b4033 JW3993 protein protein ecoli Escherichia coli (strain K12) MDVIKKKHWWQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD malg_ecoli Maltose/maltodextrin transport system permease protein MalG JW3992 b4032 malG protein protein ecoli Escherichia coli (strain K12) MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG malk_ecoli Maltose/maltodextrin import ATP-binding protein MalK malK b4035 JW3995 protein protein ecoli Escherichia coli (strain K12) MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV sn-glycero-3-phosphocholine glycerol-3-phosphocholine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ugpc-ugpa 1461268 n/a 1461273 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461274 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461275 stimulator stimulator neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461276 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461277 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1461278 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1461279 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) atpase reaction atpase reaction false false false Fig. 4b P0AG80 and CHEBI:15978 increases activity of P10907. CHEBI:30528 decreases activity of P10907. ugpc-ugpa-1 1461268 n/a 1461273 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461276 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461277 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1461278 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) atpase reaction atpase reaction false false false Fig. 4b Without UgpB and G3P only residual ATPase activity is observed. ugpc-malf 1461268 n/a 1461279 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461280 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461273 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461281 stimulator stimulator neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461276 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461282 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1461283 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) atpase reaction atpase reaction false false false Fig. 4b P0AEX9 and CHEBI:17306 increases activity of P10907. CHEBI:30528 decreases activity of P10907. ugpc-malf-1 1461268 n/a 1461273 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461282 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1461276 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461283 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) atpase reaction atpase reaction false false false Fig. 4b Without UgpB and G3P only residual ATPase activity is observed. ugpc-ugpa 1461269 n/a 1461276 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461277 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1461278 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1, 4c Pulldown in Fig. 4b is after reconstitution of the complex in proteoliposomes. ugpc-malf 1461269 n/a 1461282 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1461276 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461283 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1, 4b Pulldown in Fig. 4b is after reconstitution of the complex in proteoliposomes. malk-malf 1461269 n/a 1461282 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1461284 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461283 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1 ugpb-sn_glycerol_3_phosphate 1461270 n/a 1461274 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461275 unspecified role unspecified role bait bait P0AG80:p.Leu172Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P0AG80:p.Trp169His mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P0AG80:p.Trp169Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P0AG80:p.Leu172His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false 24-438 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1461270 Fig. 2a, d, e ugpb-gpc 1461270 n/a 1461285 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461275 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 24-438 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1461270 Fig. 2b ugpc-ugpa-32p 1461271 n/a 1461275 stimulator stimulator neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461274 stimulator stimulator neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461273 enzyme target enzyme target substrate substrate neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461278 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1461276 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461277 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) atpase reaction atpase reaction false false false Fig. 5b, c CHEBI:37586 causes no change to P10907. P10908 causes no change to P10907. P0A9K7 causes no change to P10907. ugpc-ugpa-32p-1 1461271 n/a 1461278 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1461273 enzyme target enzyme target substrate substrate neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1461276 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1461277 ancillary ancillary neutral component neutral component ecoli Escherichia coli (strain K12) atpase reaction atpase reaction false false false Fig. 5b, c Without UgpB and G3P only residual ATPase activity is observed. ugpb-sn_glycerol_3_phosphate-1 1461272 n/a 1461275 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 24-438 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1461274 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Fig. 3a, b, c R = 0.16, Rwork = 0.1, Rfree = 0.19 1.8 A